KEGG   Arachis ipaensis: 107611935Help
Entry
107611935         CDS       T04301                                 

Definition
(RefSeq) probable sesquiterpene synthase
Organism
aip  Arachis ipaensis
SSDB OrthologParalogGFIT
Motif
Pfam: Terpene_synth_C ANTAR DUF4378
Motif
Other DBs
NCBI-GeneID: 107611935
NCBI-ProteinID: XP_020964653
Position
B08
AA seq 346 aa AA seqDB search
MKARSYMSFYEENPSCDKVDLLSFAKLDFNMVQKLYKKEIGSNTKWWRELDFATKVPYAR
DRVVEGFFWPFATNSEPKYSTARQMITKLSICISLVDDTFDVYGTVEELELFTKAIQRWD
IRCIESLPDCFKVIFNAIMECWMEIEVFMNDVGGDSNLVLQHVKQAFSNIVQAYMVEAKW
CHEDYIPTYDDYKINGILTSGNPLFTTMFIALGEFASKEMFDWISNIPFILKATSFVGRL
TNDLSSHKFEQQRKHVASAVESCMKQYNFSEEEAYEFIKKDINDSWKDMNEEYLKLTEEI
PRPILDCIVNLARICEFIYANFEDKYTNCELLNDDIMALLLDPIIV
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcaaggtcatatatgtctttttatgaagaaaatccttcctgtgacaaggttgat
cttctaagctttgcaaaattggatttcaatatggtacaaaaattatataaaaaagaaatt
ggtagtaacaccaagtggtggagagaattagattttgcaacaaaggttccttatgcaaga
gatagggtagttgaaggattcttttggccttttgctacgaactctgagcctaaatatagc
actgcaagacaaatgataaccaaattgtctatatgtatctctcttgtggatgatactttt
gatgtttatggcacagttgaagaacttgaactcttcaccaaagcaatccaaagatgggat
attcgatgcattgagtctcttccggattgctttaaagttatttttaatgcaattatggaa
tgctggatggaaatagaggttttcatgaatgatgtgggtggagactcaaacttagtgttg
caacatgttaaacaggctttttctaatatagtacaagcttacatggttgaagcaaaatgg
tgccatgaggactatattccaacatatgatgactacaagattaacggaattctcacttca
ggaaacccattgttcacaacaatgttcattgctcttggagaatttgcatccaaagaaatg
tttgattggatttctaatattcccttcatcttaaaagccacatcatttgttggcagacta
acaaatgatttgtcctcacataagtttgaacaacaaaggaaacatgttgcttctgcagta
gaaagttgcatgaagcagtataacttttcagaagaggaggcctatgaattcatcaaaaag
gatatcaatgattcttggaaggatatgaacgaagagtatctcaagttaaccgaggaaatc
ccaagacccatccttgattgcattgttaacttggctcgcatatgtgagtttatatatgca
aactttgaagataaatacaccaattgtgaacttttgaacgatgacatcatggcactgctt
ttggaccccatcatcgtgtag

DBGET integrated database retrieval system