KEGG   Arachis ipaensis: 107613914Help
Entry
107613914         CDS       T04301                                 

Definition
(RefSeq) arogenate dehydratase 3, chloroplastic
  KO
K05359  arogenate/prephenate dehydratase [EC:4.2.1.91 4.2.1.51]
Organism
aip  Arachis ipaensis
Pathway
aip00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aip01100  Metabolic pathways
aip01110  Biosynthesis of secondary metabolites
aip01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aip00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    107613914
Enzymes [BR:aip01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     107613914
    4.2.1.91  arogenate dehydratase
     107613914
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDT ACT
Motif
Other DBs
NCBI-GeneID: 107613914
NCBI-ProteinID: XP_016171594
Position
B08
AA seq 430 aa AA seqDB search
MTTLTQPPSNALSLSYLLKQHSKRPGPNRLTVKCVYAFEPTSFGIGSNRVDWQSSCAILS
SKVFSEEKSSASSNSTGNNNSAADNIAAVNGHKTAVTDLNLVPINGSADSAKPLPPKPLT
ISDLSPAPMHGSQLRVAYQGVPGAYSEAAAGKAYPNCEAIPCDQFEVAFQAVELWIADRA
VLPVENSLGGSIHRNYDLLLRHRLHIVGEVQLPVHHCLLALPGVRKEYLSRVISHPQALA
QCEHTLTKLGLNVAREAVDDTAGAAEFVAVNCLRDTAAIASARAAELYGLQVLADGIQDD
PSNVTRFVMLAREPIIPRTDRPFKTSIVFAHDKGTSVLFKVLSAFAFRNISLTKIESRPH
RNRPIRLVDDANVGTAKHFEYLFYVDFEASMADVRAQNALAEVQEFTSFLRVLGSYPMDM
TPWTPSSRGN
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccctaacgcagccaccttccaatgctctcagtctcagttacctcctaaaacag
cattccaaacggcccggcccgaaccgattaactgttaaatgcgtttacgccttcgaaccc
accagcttcggaatcggctccaaccgagtggactggcagagctcctgcgccattttatcc
agcaaagtcttttcggaggaaaaatcttctgcttcctctaattccaccggaaacaacaac
tctgccgctgataacatcgccgctgttaacggccacaaaaccgctgttacggaccttaat
ctcgtcccaattaacggcagtgcagacagcgccaagccgctccctcccaagccgctaacg
atttctgacctctcgccggctccaatgcacggttcgcagcttcgcgttgcgtaccaaggc
gttcccggcgcatactccgaggccgccgccggaaaagcttaccctaactgtgaggccata
ccgtgcgaccagtttgaggtggcgttccaggcagtggagctctggattgccgaccgcgcc
gtactcccggttgaaaactcccttggcggatcgatccaccggaactacgatctcctcctc
cgccaccgcctccacatcgttggcgaggtacagctccctgtccaccactgcctcctcgct
ctccccggcgtacgaaaggagtacctcagccgcgtaatctcgcaccctcaagctctagct
cagtgtgagcacactctcacaaagctcggcctcaacgtggctcgcgaggccgtcgacgac
accgccggcgccgcagagttcgtggcagtcaactgcctccgcgacacggctgcaatcgcg
agcgctcgcgcggcagagctgtatggactccaggttttagcggatgggatccaagacgac
ccgagcaacgtaacccgattcgtgatgctggcacgagaaccgataattccccgtacagat
aggccgttcaaaacgagcattgtttttgcgcacgataagggcacttcggtacttttcaag
gtgctatcggcgttcgccttcaggaacataagcttgacgaagattgagtcgcggccgcac
aggaaccgtccgatcagactcgtggatgatgcgaacgttggaacggccaaacactttgag
tatctattctacgttgattttgaggcgtccatggcagacgttagggcgcagaacgccttg
gcagaggtgcaggaattcacctctttcttgagggtcttgggtagttatcccatggacatg
accccttggacaccctcttccagaggaaattag

DBGET integrated database retrieval system