KEGG   Arachis ipaensis: 107615503Help
Entry
107615503         CDS       T04301                                 

Definition
(RefSeq) glutathione S-transferase zeta class-like
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
aip  Arachis ipaensis
Pathway
aip00350  Tyrosine metabolism
aip01100  Metabolic pathways
Module
aip_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:aip00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    107615503
Enzymes [BR:aip01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     107615503
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3
Motif
Other DBs
NCBI-GeneID: 107615503
NCBI-ProteinID: XP_020967525
Position
B09
AA seq 164 aa AA seqDB search
MICSLGFKFLKLNPIGFVPVLVDGDLVLADSLAIIMYLDDKYPQHPLLLSDIHKRAINFQ
LHLLCVILIMSSHPQATHIISSSIQPLQNISFLNYIGEKVGPDKKLPCVQGVLRKGFTAL
EKLLKDHTGRYATGDEISWYVGILRGQMIPFKGADAIVSCVILE
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgatatgctctcttggattcaaattcctcaagctcaaccccattggtttcgtgccggtt
ctggtggatggcgatcttgtgcttgctgactccttagccattattatgtatctggatgat
aagtatcctcaacaccctttgctgcttagtgatattcacaaaagagcaatcaatttccag
ctacacctgctctgtgtcattctaatcatgtcatctcatccacaagctacccacatcatt
tcctcgtccatacagcctcttcaaaacataagctttctgaattacatcggggaaaaagtc
ggccctgacaaaaagcttccttgtgtacaaggtgtccttagaaagggcttcacagcactt
gaaaaactcttgaaggaccacacgggaagatatgcaacgggagatgaaatttcctggtat
gttggtattttaagggggcagatgattccttttaagggggcagatgctatagtctcatgt
gtgatattggaatag

DBGET integrated database retrieval system