KEGG   Arachis ipaensis: 107617644Help
Entry
107617644         CDS       T04301                                 

Definition
(RefSeq) heat shock 70 kDa protein 5
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
aip  Arachis ipaensis
Pathway
aip03040  Spliceosome
aip04141  Protein processing in endoplasmic reticulum
aip04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:aip00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    107617644
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107617644
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107617644
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aip01009]
    107617644
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:aip03041]
    107617644
   03009 Ribosome biogenesis [BR:aip03009]
    107617644
   03110 Chaperones and folding catalysts [BR:aip03110]
    107617644
   04131 Membrane trafficking [BR:aip04131]
    107617644
   03051 Proteasome [BR:aip03051]
    107617644
   03029 Mitochondrial biogenesis [BR:aip03029]
    107617644
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aip04147]
    107617644
Protein phosphatases and associated proteins [BR:aip01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     107617644
Spliceosome [BR:aip03041]
 Complex B
  Other components
   Prp19 complex
    107617644
 Complex C
   Prp19-CDC5 complex
    107617644
Ribosome biogenesis [BR:aip03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    107617644
Chaperones and folding catalysts [BR:aip03110]
 Heat shock proteins
  HSP70 / DNAK
   107617644
Membrane trafficking [BR:aip04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    107617644
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    107617644
Proteasome [BR:aip03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    107617644
Mitochondrial biogenesis [BR:aip03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    107617644
Exosome [BR:aip04147]
 Exosomal proteins
  Proteins found in most exosomes
   107617644
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A Zincin_2
Motif
Other DBs
NCBI-GeneID: 107617644
NCBI-ProteinID: XP_016174942
Position
B09
AA seq 644 aa AA seqDB search
MATATEKAIGIDLGTTYSCVAVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ
VAMNPQNTVFDAKRLIGRRFSDPSVQSDMRHWPFKVVSGPQDKPMIVVNYKGEQKQFAPE
EISSMVLTKMKEIAEAYLGKTIKNAVVTVPAYFNDSQRQATKDAGAIAGLNVMRIINEPT
AAAIAYGLDKKASKTGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDN
RLVNHFAAEFKRKHKKDMSSNARALRRLRTACERAKRTLSSTAQTTIEIDSLFEGIDFYA
TITRARFEELNMDLFRKCMEPVEKCLRDAKVDKAQIHDIVLVGGSTRIPKVQQLLQDFFN
GKELCKSINPDEAVAYGAAVQAAILSGEGDQKVQDLLLLDVTPLSLGIETAGGVMTVLIP
RNTTIPTKKEQVFSTYSDNQTSVLIQVYEGERARTKDNNLLGTFELKGIPPAPRGVPQIN
VCFDIDANGILNVSAEDKTAGVKNKITISNDKGRLSKEEIERMVQEAEKYKAEDEQVKKK
VDAKNSLENYAYSMRNTIKDDNVGAKLDPSDKQRIEKAIDDTIQWLDGNQLAEVDEFEDK
LKELEALCNPVISKMYQGGGTAAPSSADAAHDNSAGGPKIEEVD
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgctactgagaaagccattggcatcgatctaggcaccacttacagctgcgtg
gccgtgtggcaaaacgaccgcgtagagatcatcgccaacgaccaaggcaaccgaaccact
ccttcgtacgttgccttcacggacaccgagcgcctcatcggagatgctgccaagaaccag
gtggcaatgaacccacagaacacggtgttcgacgccaagcgcctcatcggtcgtagattc
tccgacccttccgtccagagcgacatgaggcactggcccttcaaggtggtctccggcccc
caagacaagcccatgatcgtcgtcaactacaaaggcgagcagaagcagttcgcacccgag
gagatttcctccatggtgctcaccaagatgaaggagatcgccgaggcctacctgggaaaa
accatcaagaacgccgtcgttaccgtccccgcctacttcaacgactctcagaggcaggcc
accaaggacgccggcgccattgcaggcctcaacgtcatgagaattatcaacgagccaacc
gccgctgctattgcctacggcttagacaagaaggcctccaaaactggcgagaagaacgtc
ctcatcttcgacctcgggggtggcacctttgacgtgtctctcctgactatcgaggagggc
atctttgaggtgaaggccactgccggagacacccacttggggggcgaggatttcgacaac
aggctggtgaatcacttcgcggcggagttcaagaggaagcacaagaaggacatgagcagc
aacgcgagagcgctacggagactgaggacagcgtgtgagagggccaagaggacactctcc
tccaccgcacagacgaccatcgagatcgactcgctctttgaaggtattgatttctacgcg
accatcactcgggccaggttcgaggaactcaacatggacctgttcaggaagtgcatggag
ccggttgagaagtgtctccgcgatgccaaggttgataaggctcagattcacgacattgtc
cttgttggcggctccaccagaatccccaaggtccagcagcttctgcaggacttcttcaat
ggcaaggagctctgcaagagcatcaaccccgacgaggccgtggcttacggggctgctgtt
caagctgccatcctgagcggcgaaggcgaccagaaagtccaagacttgcttcttctcgac
gtcacgcccctcagcctgggcattgaaaccgccggtggggtgatgacggtcttgattccc
aggaataccaccatacccaccaagaaagagcaggtgttttccacctactcggacaaccag
accagcgtgctgattcaggtgtacgagggtgagagggcaagaaccaaggacaacaacctt
ttgggaacatttgagctcaaggggattccgccggcgccgagaggggtgcctcagatcaac
gtgtgcttcgacatcgatgccaacggtatcttgaacgtgtctgcggaggacaagacggcg
ggggtgaagaacaagatcaccatcagcaacgacaaaggaaggctgagcaaagaggagatt
gaaagaatggtgcaggaggcagagaagtacaaagcagaggatgaacaggtcaagaagaaa
gtggacgccaagaactcactggagaattatgcttacagcatgaggaacaccatcaaggat
gacaatgttggtgccaaacttgatccttctgacaagcagaggatcgagaaggccattgat
gacaccatccaatggttggacgggaaccagttggcggaagtagatgagtttgaggacaag
ctcaaggagcttgaggctttatgcaaccctgtcatttccaagatgtatcaaggtggtggt
actgctgctccatcctctgccgatgctgcccatgacaactccgctggtggacctaagatt
gaagaggttgattga

DBGET integrated database retrieval system