KEGG   Arachis ipaensis: 107617719Help
Entry
107617719         CDS       T04301                                 

Definition
(RefSeq) methionine--tRNA ligase, chloroplastic/mitochondrial
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
aip  Arachis ipaensis
Pathway
aip00450  Selenocompound metabolism
aip00970  Aminoacyl-tRNA biosynthesis
aip01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aip00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    107617719
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    107617719
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:aip01007]
    107617719
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:aip03016]
    107617719
Enzymes [BR:aip01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     107617719
Amino acid related enzymes [BR:aip01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   107617719
Transfer RNA biogenesis [BR:aip03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    107617719
 Prokaryotic type
   Other AARSs
    107617719
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 Memo
Motif
Other DBs
NCBI-GeneID: 107617719
NCBI-ProteinID: XP_016175046
Position
B09
AA seq 597 aa AA seqDB search
MAARMNTLSLLNPSHVSLRPRDSRFSHRPLRFYSSPNPNRRALFCTCSTTNGESFVLTTP
LYYVNAPPHMGSAYTTIAADAVARFQRLLGKKVIFITGTDEHGEKIAAAAMAQGSTPLDH
CNVISQAYKTLWKDLDISYDKFIRTTDSKHEAIVKEFYSRVLAKGDIYQADYEGLYCVNC
EEYKDEKELLENNCCPVHLKPCDSRKEENYFFALSKYQKSLEEALNKNPNFVQPSFRLNE
VQSWVKGGLRDFSISRASVDWGIPIPNDRSQTIYVWFDALLGYISALSDEQEQPDLLNAV
SSGWPAALHLIGKDILRFHAVYWPAMLMSAGLSLPKMVFGHGFLTKDGMKMGKSLGNTLE
PNELVHRFGTDAVRYFFLREVEFGSDGDYSEERFINIVNAHLANTIGNLLNRTLGLLKKN
CQSTLVVDSTTAAEGNEFKDNVEKLVDKARMHYENLSLSSACEAVLEIGNVGNFYMDERA
PWSLFKQGGTASEAAAKDLVIILETARIIAIALLPVTPSLSWRIYEQLGYSRDQFDAATW
GDTKWGGLKGGQVMAQPKPVFARIENQTEDVDKGVAVGKTMKSKGKKMKQAQQVAGA
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggcagctagaatgaacactctctcccttctgaacccttctcacgtctctctgcgcccc
agagattctcgattctctcacaggcccctcagattctactcttctccgaaccctaaccgc
agagctttgttctgcacatgctccaccacaaatggcgaatcctttgtcctcacaacccct
ctctactacgtcaatgcccctccccatatgggcagcgcctacaccaccatcgccgccgat
gccgttgctcgctttcagcgactattgggaaagaaagttatattcattactggcaccgat
gaacatggagaaaaaattgcagctgctgcaatggcccagggttccaccccacttgatcac
tgcaatgtcatctcacaagcttacaagacactgtggaaagatttagatatttcctacgac
aaattcattagaacaactgatagtaagcatgaagcaattgtgaaggaattttattcaaga
gtgctcgccaaaggtgacatttatcaagcggattacgagggactttattgtgtgaactgc
gaggaatacaaggatgagaaggaattgcttgagaataattgctgtcctgttcacctaaag
ccatgtgattctaggaaagaggaaaactatttctttgcactttcaaaataccagaagtca
ttagaggaagctttgaataaaaacccgaattttgtgcaaccttctttccgtttaaacgag
gttcaaagctgggttaaaggtggccttagggacttctctatttcacgagcatcagttgat
tggggaatccctattcccaatgacagaagtcaaactatatatgtatggtttgatgcttta
cttggctatatatcagcgctatctgatgagcaggagcagcctgatctactaaatgctgtt
tcttcaggttggccagctgcattgcacttgattggtaaggatattctacgcttccatgct
gtttactggccagctatgctaatgtctgctggactaagtcttcctaaaatggtttttggg
catggattcttgacaaaggatggcatgaagatgggaaagtcactagggaatactcttgaa
ccaaatgaattagttcatagatttgggacagatgcagttagatacttcttcctcagagag
gtggaattcggcagtgatggagactattcagaggaacgcttcatcaatattgtgaatgca
catcttgccaacacaatcggaaatcttcttaatcgtacactgggacttctaaaaaagaac
tgccaatcaactctggtggttgattctactactgcagcggaaggaaatgaattcaaagac
aacgtagagaagctggttgataaagctcgtatgcactatgagaatctttccctgtcatca
gcttgtgaagctgttcttgagattggtaatgttggtaatttctatatggatgagcgagca
ccatggtctctgtttaagcaaggtgggactgcttctgaagcagctgcgaaggatcttgta
attatattggagacggcgagaattattgcaattgcattacttcctgttacaccgagcttg
agttggagaatatacgaacagcttggctattcccgggaccaattcgatgcagcaacttgg
ggagacacaaagtggggcgggcttaaaggtggccaagtcatggctcaaccaaaaccagtc
tttgcaaggattgaaaaccaaactgaagatgtggacaaaggtgttgcagttggaaagaca
atgaaaagtaaaggcaagaagatgaaacaagcccagcaagtcgccggggcttag

DBGET integrated database retrieval system