KEGG   Arachis ipaensis: 107617943Help
Entry
107617943         CDS       T04301                                 

Definition
(RefSeq) probable serine/threonine-protein kinase WNK9
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
aip  Arachis ipaensis
Brite
KEGG Orthology (KO) [BR:aip00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aip01001]
    107617943
   01009 Protein phosphatases and associated proteins [BR:aip01009]
    107617943
Enzymes [BR:aip01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107617943
Protein kinases [BR:aip01001]
 Serine/threonine kinases: Other
  Wnk family
   107617943
Protein phosphatases and associated proteins [BR:aip01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107617943
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Pkinase_fungal POC1
Motif
Other DBs
NCBI-GeneID: 107617943
NCBI-ProteinID: XP_016175324
Position
B09
AA seq 758 aa AA seqDB search
MNGVTHLEPEPDDPSEFVEVDPTGRYGRYNEILGKGASKTVYRAFDEYQGIEVAWNQVKL
YDFLQSPEDLERLYCEIHLLKTLKHKNIMKFYTSWVDTANRNINFVTELFTSGTLRQYRL
KHKRVHIRAVKHWCRQILRGLLYLHSHDPPVIHRDLKCDNIFINGNQGEVKIGDLGLAAI
LRKSHAAHCVGTPEFMAPEVYEEAYNELVDIYSFGMCILEMVTFEYPYSECTHPAQIYKK
VISGKKPDALYKVKDPEVREFVEKCLATVSLRLSARELLDDPFLRVDDYDYDLRPVDGGE
LDDLGPLIRQPLFDLHRSYSNISNEYSNGFGYEGDWSSHPAEIEPNGIELFEYHDDDDEE
TSEDVDISIKGKRKDDGGIFLRLRIADKEGRIRNIYFPFDIEMDTAISVAAEMVAELDIT
DQDVTRIADMIDGEIASLVPDWRRGPGIDESPRFSNQGLCHNCVSNHTSSGSLLDFISQN
PGSKNPKLGECCRRGCTSMHGRFEEITFESEDYDNHVRENVPNISSQSHSLQYQGLWNQH
ESRELSPVASDQSHSDEQYEQLDKSIAAEDKGQDHWETKFVSNAGSSLRNLSGTHDLSTI
RSLCCDLEGDYEEEIQKELRWLKAKYQMELRELKDQHLGLMPKSSSSNSNDKEENKTEHQ
LVMPLHLLTKTLKASNNNNVIHLKPFTNNLNCDATTNHLPHCNKSIPDLDAQRAQNREAM
ESLREEEGMVNAKNFFSGTLLPHSLHRTVSLPVDAVDV
NT seq 2277 nt NT seq  +upstreamnt  +downstreamnt
atgaatggtgtcacccaccttgaaccagaaccagacgatccttctgagtttgttgaagtt
gatccaactggaagatacggaagatacaatgaaatcctcggcaaaggagcttcaaagaca
gtatatagagcatttgatgagtatcaagggattgaagttgcttggaaccaggtcaagctt
tatgatttcctgcaaagtcctgaagatcttgagaggctctactgtgaaattcatctcttg
aagacattgaagcacaagaacattatgaaattctacacatcttgggttgacactgccaat
aggaacatcaattttgtcactgaattgttcacttctggtactctcagacagtatagatta
aagcacaagagagtgcatatcagagcagtgaagcattggtgcagacagatcttgagaggg
cttctctatcttcatagccatgatccacctgtgatccatagagatctcaaatgtgacaat
atttttatcaatggaaaccaaggggaggtgaagattggagatcttggcctggctgcgatt
ctccggaaatctcatgctgctcattgtgtaggaacgccagagttcatggcccctgaagtt
tacgaagaggcatataatgaattggtcgacatatattcatttggtatgtgcatattagag
atggttacctttgaatatccttatagtgaatgcactcatccagcgcaaatctacaagaaa
gttatttccggtaaaaagccggatgctttgtacaaagtgaaggatccagaagtgcgagaa
tttgttgagaaatgcttggcaactgtttctttaaggctatctgcaagggagcttctagat
gacccgtttcttcgagttgatgattatgattatgatttgagacctgtagacggtggggaa
ttggatgacttaggccctctcattaggcagccattatttgatcttcatcgaagctatagc
aacattagtaacgaatactcgaatggttttgggtatgaaggagactggtcatcgcatcca
gctgagattgaacctaatggaatagaactttttgagtaccatgacgatgatgatgaagaa
acgtctgaagatgttgacataagcatcaagggcaagaggaaagatgatggtggcatattt
ttgagactaagaatcgcagataaagaaggccgtattcgaaatatttatttcccattcgac
attgagatggacacagcaattagtgtggcagcagaaatggttgcagagcttgacattacc
gatcaggatgttaccagaatagctgatatgatagatggtgaaattgcttctttggtacct
gattggaggcgtggaccaggaatcgatgaatctccccgattttccaatcagggtttatgt
cacaattgtgtctcgaatcatacctccagcggatcgcttctggatttcatttcgcagaat
ccgggcagcaaaaaccccaaacttggcgagtgttgtaggcgtggatgtacttcaatgcat
ggacgattcgaggagatcaccttcgaatctgaggattacgacaatcatgttagagagaat
gtacccaacatatcaagccagtcacacagcttacagtaccagggtttatggaatcagcac
gaaagccgcgaactcagtccggtagcgtccgatcaaagccattctgacgaacaatacgaa
caactagacaaatcaatagctgctgaagataaagggcaggatcattgggaaaccaagttt
gtctccaacgctggaagctctctgcgtaatttatcaggaacccacgatttatctactatt
cgatcgttatgttgtgacctagagggtgactacgaggaagagatccaaaaggagctgaga
tggctcaaagcgaaataccaaatggagttaagggaactcaaagatcaacaccttggccta
atgcctaaatcttcttcttccaacagcaatgacaaagaggaaaacaaaactgaacaccaa
cttgttatgccgctgcatttgctgacaaaaactttgaaagcaagcaacaataacaatgtg
attcatttgaaaccctttaccaataacttgaactgtgatgccactactaaccatcttcct
cactgcaacaagagcatccccgatctggatgcccaaagggcccagaatcgcgaggcgatg
gaatcacttcgtgaagaagaaggtatggttaatgctaagaactttttttctggtacattg
cttcctcactcgcttcatagaacagtttcccttccagttgatgctgttgatgtataa

DBGET integrated database retrieval system