KEGG   Arachis ipaensis: 107623366Help
Entry
107623366         CDS       T04301                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1 isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
aip  Arachis ipaensis
Pathway
aip00010  Glycolysis / Gluconeogenesis
aip00562  Inositol phosphate metabolism
aip01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aip00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107623366
   00562 Inositol phosphate metabolism
    107623366
Enzymes [BR:aip01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     107623366
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     107623366
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 107623366
NCBI-ProteinID: XP_020968703
Position
B10
AA seq 492 aa AA seqDB search
MKKPIVALLMVIFFFAFNCFNAEEAFDVRKHLSTVSRYGAVKEIANGNFIPSKVPEGCVP
THLNLVARHGTRSPTKKRIRELDNLSLRLEDLIKDARGRNLHLERVPSWLDGWKSPWQGR
LKGGELVSKGEEELYDLGLKIREKFPSLFDEEYHPNIYTIRATQVPRASASAVAFGMGLY
SGNGSLGPGKHRAFSVISESRASDIMLRFHDCCHNYKHFREKQEPAVNKLKEPVLNEITS
ALIGRYGLNFTRQDISSLWFLCKQEASLLDITNQACSLFGPSEIMLLEWTDDLEAYILKG
YGNSLNYRMGLPLLEDVVQSMEQAIQAEEERRPPGSFEKARLRFAHAETIIPFSCLLGLF
LDGSEFTKIQKEQPLQLPPKPPQKRTWRGSTLAPFAGNNMLILYSCPAQDKSKSKHFVQV
LHNEHPIPMPGCDGSDFCSFEVFKEKIVAPHQKHDYDTVCNPKQEPSSGSIYQMFQWLFS
LSKGDKRPRDEF
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagcctatcgtagctttgttaatggtaatattcttttttgcgttcaactgcttc
aacgccgaagaagccttcgatgttcgcaagcatctctccacggtttccaggtatggtgct
gtgaaagaaattgcaaacggtaattttataccttctaaagttcctgaaggatgtgttcca
actcacttaaatctcgtggcaaggcatggaactcgttctcctacaaagaaaaggataaga
gagttagataatttgtcgttacgtttggaagatcttataaaggatgccagagggcgaaat
ttgcatttggaaagagttccttcctggctagatggatggaaatctccctggcaaggaagg
ctcaagggtggtgagttggttagcaaaggagaggaagaattatatgatcttggactcaaa
attagagaaaagtttccaagtttgtttgatgaagagtaccatccaaacatatatacaata
agggcaactcaggttcctcgagcctcggccagtgcggtagcatttgggatggggctttat
agtggaaatggtagccttggacctggaaaacatcgagcattttctgttataagtgaaagc
cgtgctagcgacatcatgctgagatttcatgattgttgtcataactacaagcattttagg
gagaagcaggaacccgctgttaataaacttaaagaacctgtattgaatgaaatcacatct
gcattaattgggcgctatggactgaattttacgaggcaggatatatcatctctttggttt
ttgtgtaaacaggaagcatccttattagacattaccaatcaagcatgcagtctttttggc
ccttctgagattatgttgctggagtggacagatgacttggaggcttatattcttaagggt
tatggtaactcgctcaactatagaatgggattgccattacttgaagatgttgtgcagtct
atggaacaagctattcaagctgaagaagaaagacgccctcccggaagctttgaaaaggca
agacttcggtttgcacatgcagaaactataattccattttcgtgtctgcttggtttattt
cttgatggatccgagtttacaaaaattcagaaggagcaacctttgcagctccctccaaag
cctccacagaaaagaacctggagaggtagcactctagccccatttgcaggcaataacatg
ctgatattgtatagttgtccggctcaagacaaatctaaaagcaagcactttgtgcaagtg
ctgcacaatgaacaccccattccaatgcctggttgtgatggttctgatttctgttcattt
gaggtcttcaaggaaaaaatagttgcacctcatcagaagcatgactatgatacagtctgt
aatccgaagcaggagccgtcctctggcagtatatatcaaatgtttcagtggcttttctcg
ctcagcaaaggtgataaacgacccagagatgaattttag

DBGET integrated database retrieval system