KEGG   Arachis ipaensis: 107625761Help
Entry
107625761         CDS       T04301                                 

Definition
(RefSeq) acyl-coenzyme A oxidase 4, peroxisomal
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
aip  Arachis ipaensis
Pathway
aip00071  Fatty acid degradation
aip00410  beta-Alanine metabolism
aip00592  alpha-Linolenic acid metabolism
aip00640  Propanoate metabolism
aip01040  Biosynthesis of unsaturated fatty acids
aip01100  Metabolic pathways
aip01110  Biosynthesis of secondary metabolites
aip01200  Carbon metabolism
aip01212  Fatty acid metabolism
aip04146  Peroxisome
Module
aip_M00087  beta-Oxidation
aip_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:aip00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    107625761
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107625761
   00592 alpha-Linolenic acid metabolism
    107625761
   01040 Biosynthesis of unsaturated fatty acids
    107625761
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107625761
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107625761
Enzymes [BR:aip01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     107625761
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2
Motif
Other DBs
NCBI-GeneID: 107625761
NCBI-ProteinID: XP_016183951
Position
B02
AA seq 439 aa AA seqDB search
MAIHSSSNQDDSSKRAMPSYFNLPPLDVSNAFPQATPASVFPPCASDYFQFDDLLTPEEQ
AVRKKVRECMEKEIAPVMTEYWEKAKFPFQCIPKLAALRLAGGTIKGYGCPGLSILGSAV
GTAEVARVDASCSTFILVHSSLAMLTIALCGSEAQKQKYLPSLAQFQTIGCWGLTEPDYG
SDASALKTTATKVEGGWILDGQKRWIGNSTFADILVIFARNTSTNQINGYIVKKDAPGLT
VTKIENKIGLRIVQNGDIVMKKVFIPDEDRLTGVNSFQDTNKVLAVSRVMVAWQPIGISM
GIYDICHRYLKERKQFGAPLAAFQINQQKLVQMLSNVQAMFLVGWRLCKLYESGKMTPGH
ASLAKSWITLRARETAALGRELLGGNGILADFLVAKAFCDIEPIYTYEGTYDINTLVTGR
EVTGFASFKPVIAQKRSRL
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggcaatccactcttcttccaatcaagatgattctagcaaaagggcgatgccgtcctat
ttcaatttaccgccactggatgtttctaatgcatttccacaagcaacaccagcgtctgta
tttcctccttgtgcttcagattattttcaattcgatgacttattgacaccagaggagcag
gcagttaggaagaaagtaagagaatgtatggaaaaagaaattgcaccagtaatgactgag
tactgggaaaaggccaagttcccatttcagtgtataccaaaacttgctgcattgcgtctc
gctggtggaacaatcaagggctatggttgtcctggcctttctattcttggtagtgctgta
ggtactgctgaagttgcaagagttgatgcaagctgttcaacttttattttggttcattca
tccttagcaatgcttactattgcattgtgtggatcagaagcccagaagcaaaagtatcta
ccttctttggcacagtttcaaactataggatgctggggtttgactgagcccgactatgga
agtgatgccagtgctttgaagactacagcaacaaaggttgaaggaggttggatcctagat
ggccaaaagcggtggataggaaacagtacgtttgctgatatattggttatctttgctagg
aatacctctacaaatcagataaatggatatattgtaaaaaaggatgcacctggtttaacc
gtcaccaaaatagagaataaaattggactcaggattgttcaaaatggagacattgttatg
aagaaagtttttatccctgatgaggacagattaacaggggtcaactcttttcaagacaca
aacaaggtacttgctgtctcacgtgtaatggttgcttggcaaccaattggcatatccatg
ggaatctatgatatatgtcataggtatttaaaggagaggaaacagtttggagcaccatta
gcagctttccagatcaaccaacagaaacttgttcagatgcttagcaatgttcaagccatg
tttctcgttggttggcgcctttgcaaattgtacgagagtggtaaaatgactcctggacat
gcaagcttggccaagtcatggatcaccttgagagcaagagaaacagctgctctgggacga
gaattacttggtggcaatggaatattggccgattttcttgtcgccaaggcattctgcgat
atagaacctatttatacgtatgaaggtacatatgacatcaacactttggttactggcagg
gaagttactggttttgctagctttaagcctgttattgcccaaaagagaagccgattgtga

DBGET integrated database retrieval system