KEGG   Arachis ipaensis: 107628486Help
Entry
107628486         CDS       T04301                                 

Definition
(RefSeq) glutathione S-transferase T1-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
aip  Arachis ipaensis
Pathway
aip00480  Glutathione metabolism
aip01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aip00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107628486
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aip02000]
    107628486
Enzymes [BR:aip01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     107628486
Transporters [BR:aip02000]
 Other transporters
  Pores ion channels [TC:1]
   107628486
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 Phage_GPO
Motif
Other DBs
NCBI-GeneID: 107628486
NCBI-ProteinID: XP_020969560
Position
B02
AA seq 98 aa AA seqDB search
MSQPSRVVLIFCKVNGIEFDEIKVEISKRQQLSPEFAAINPFKKLLAIVDGRFKLFESHA
TLIYLASAFPGIADHWLVLSPFHLFNHNNFLMTPQICE
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaaccatctcgtgtcgttcttatcttctgcaaagttaatggaatagaattcgac
gagattaaagttgaaatctccaaaagacagcagttatctcccgaatttgcagctatcaac
cctttcaagaaactccttgctattgttgatggaaggttcaagctattcgagagtcacgca
actcttatctatcttgcttctgcctttcctggtattgctgatcattggttggtattatcc
ccttttcacttatttaatcacaataattttcttatgactccacagatatgtgaatga

DBGET integrated database retrieval system