KEGG   Arachis ipaensis: 107629120Help
Entry
107629120         CDS       T04301                                 

Definition
(RefSeq) UDP-glucuronic acid decarboxylase 6
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
aip  Arachis ipaensis
Pathway
aip00520  Amino sugar and nucleotide sugar metabolism
aip01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aip00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    107629120
Enzymes [BR:aip01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     107629120
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase Polysacc_synt_2 NAD_binding_4 3Beta_HSD RmlD_sub_bind KR adh_short
Motif
Other DBs
NCBI-GeneID: 107629120
NCBI-ProteinID: XP_016187307
Position
B03
AA seq 342 aa AA seqDB search
MAANASNGAAKQPPQPSPLRFSKFFQSNMRILVTGGAGFIGSHLVDRLMENEKNEVIVVD
NFFTGSKDNLRKWIGHPRFELIRHDVTEQLLVEVDQIYHLACPASPIFYKYNPVKTIKTN
VIGTLNMLGLAKRVGARILLTSTSEVYGDPLVHPQPETYWGNVNPIGVRSCYDEGKRVAE
TLMFDYHRQHGIEIRIARIFNTYGPRMNIDDGRVVSNFIAQALRGEPLTVQLPGTQTRSF
CYVSDMVDGLIRLMEGENTGPINIGNPGEFTMTELAETVKELINPDVEIKMVENTPDDPR
QRKPDITKAKELLGWEPKVKLRDGLPLMEEDFRLRLGVPKKN
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggcagccaatgcttctaatggagcagcaaagcaacctcctcagccatctcccttgcgc
ttctccaagttctttcagtccaatatgagaattttggttactggaggagctggatttatt
ggctctcacctagttgacagattgatggaaaatgagaagaatgaggtcatagtcgttgat
aacttcttcactggatctaaagacaaccttagaaagtggattggtcatcctagatttgag
ttaattcgtcacgatgtcacggagcaattactggtggaggttgatcaaatttaccacctt
gcttgccctgcttctccgattttctacaaatacaatcctgtaaagaccataaagacaaat
gtgattggaacactgaacatgctcggacttgctaagcgagtgggagcaaggattttactt
acatctacttcagaggtatatggagatccccttgtgcatccacaaccagaaacctattgg
ggaaatgttaaccctattggagttcgaagttgttatgatgagggcaagcgagttgcagaa
actttgatgtttgattatcataggcaacatggaattgaaatccgaattgcaagaatcttt
aatacatatggacctcgaatgaacattgatgacggccgtgttgtcagcaatttcattgct
caagcactccgtggtgaacccctaacggtccaacttccaggaactcaaactcgcagcttc
tgctatgtctctgacatggttgatggccttatccgtctaatggaaggcgaaaacacaggt
ccaatcaacattgggaacccaggcgagtttactatgactgaacttgctgagactgtgaaa
gagcttattaatccagatgtggaaatcaagatggttgagaacacaccagatgatccaaga
cagagaaaaccagacataacaaaagcaaaggaattgcttggttgggaaccaaaggtcaag
ttgagggatggccttcctcttatggaagaggatttccgtttgaggcttggtgttcccaaa
aagaactaa

DBGET integrated database retrieval system