KEGG   Arachis ipaensis: 107629623Help
Entry
107629623         CDS       T04301                                 

Definition
(RefSeq) alcohol dehydrogenase-like 1
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
aip  Arachis ipaensis
Pathway
aip00010  Glycolysis / Gluconeogenesis
aip00071  Fatty acid degradation
aip00350  Tyrosine metabolism
aip01100  Metabolic pathways
aip01110  Biosynthesis of secondary metabolites
aip01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aip00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107629623
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107629623
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    107629623
Enzymes [BR:aip01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     107629623
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     107629623
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C Glu_dehyd_C ADH_zinc_N_2 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 107629623
NCBI-ProteinID: XP_016187934
Position
B03
AA seq 375 aa AA seqDB search
MTNTSKVITCKGAVCWGAGEAVRLEEIQVDPPKANEVRVKMICASICHTDITTIQGLLPF
FRYPIALGHEGVGVVESVGDGVTNLKEGDMVIPTYIGECQECENCISGKSNLCLTYPMRM
SALMPDNTSRLSCKGNSLYYCLTFATWSEYTVIDVNYLIKVDPIINPAHASFISCGFSTG
YGAAWREAKVESGSSVVVFGLGAVGLGAISGAKMLGARKIIGIDTNNLKREKGEAFGMTH
FINPNDSDKSPSTLVKELSDGFGVDYSFECTGVAPLLTECLEATKMGSGKAISIGAGNEA
TVPLGQFSLLFGRTLKGSIFGGLKAISDLSIIADKCLKQEFPLEELHTHEVQLEDVNEAF
ELLKQPNCVKIVIKM
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacacttcaaaggttattacatgcaaaggtgctgtttgttggggtgctggtgaa
gctgtgagattagaagagatacaagttgatccaccaaaagcaaatgaagttcgagtcaag
atgatttgtgctagcatctgccacactgatatcaccaccattcaaggattattaccattt
tttcgttatccaatagctcttggtcacgaaggagttggggttgtggaatcagttggagat
ggagtgacaaatctaaaagaaggggatatggtgattccaacatacataggagagtgccaa
gaatgtgagaattgcatttcaggaaaatcaaacttgtgcttaacatatcctatgaggatg
agtgccttgatgccagataacacttcaagattgtcctgcaaaggcaacagcttatattac
tgtttaactttcgccacgtggtccgagtacacggttatcgatgttaactaccttattaag
gttgatccaatcattaatccagctcatgccagcttcatctcatgtggattctcaactggc
tatggagctgcatggagagaagccaaagttgaaagtggatcaagtgttgttgtttttggt
cttggtgctgttggattaggggctataagtggagcaaaaatgttgggggcaagaaagata
ataggaattgacacaaataacttgaagagagaaaaaggagaagcatttggaatgactcac
tttataaatccaaatgattctgataaatctccttcaacattggtgaaagaattgagtgat
ggatttggtgtggattattcatttgagtgcactggagttgcccctttgctcactgaatgc
ttagaagccacaaaaatgggaagtggcaaggcaatatcaattggagcaggaaatgaagct
actgtgcctcttggtcaattttcacttctttttggcagaactttgaaaggttctattttt
ggagggcttaaagccatttcagatctttctattatagctgacaagtgcctcaagcaggag
tttcctcttgaagaattacacacccatgaggtccaattggaagatgtaaacgaagcattt
gagttgttgaaacagcccaactgtgtgaaaattgtcatcaagatgtga

DBGET integrated database retrieval system