KEGG   Arachis ipaensis: 107630145Help
Entry
107630145         CDS       T04301                                 

Definition
(RefSeq) thiamine thiazole synthase, chloroplastic
  KO
K03146  cysteine-dependent adenosine diphosphate thiazole synthase [EC:2.4.2.60]
Organism
aip  Arachis ipaensis
Pathway
aip00730  Thiamine metabolism
aip01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aip00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    107630145
Enzymes [BR:aip01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.60  cysteine-dependent adenosine diphosphate thiazole synthase
     107630145
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thi4 DAO FAD_binding_2 NAD_binding_8 Pyr_redox_2 Lycopene_cycl NAD_binding_9 GMC_oxred_N Pyr_redox_3 GIDA HI0933_like FAD_oxidored FAD_binding_3 RNA_pol_Rpb1_3
Motif
Other DBs
NCBI-GeneID: 107630145
NCBI-ProteinID: XP_016188690
Position
B03
AA seq 354 aa AA seqDB search
MASTTISSPSFTKTASPSSLLSHNTVFRLNPQQHARKNFNLSLRASMSASSPSQPPYDLQ
SFKFEPIRESIVSREMTRRYMTDMVTHADTDVVIVGAGSAGLSCAYELSKNPSINIAIIE
QSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGIEYDEQENYVVIKHAALFTSTIMSKLL
ARPNVKLFNAVAAEDLIVKNNRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHD
GPFGATGVKRLKSIGMIDSVPGMKALDMNAAEDAIVKLTREIVPGMIVTGMEVAEIDGAP
RMGPTFGAMMISGQKAAHLALRALGLPNAMDYAGNISHPELVLAAAQSPHVVDA
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaccaccatctcctctccctccttcaccaaaaccgcaagcccttcttctctc
ctctcccataacaccgtgttccgcctgaacccccaacaacatgcacgcaaaaacttcaac
ctctccctccgcgcatccatgtcagcatcatcaccatcacaaccaccgtacgatctccag
tccttcaagttcgagccaatcagggagtcgatcgtgtcacgggagatgacccgcaggtac
atgacagacatggtgacgcacgccgacaccgacgttgtgatcgtgggtgccggttctgcc
gggctgtcgtgcgcctacgagctcagcaagaacccgtcaatcaacatagccatcattgaa
cagtctgtcagtcccggtggtggcgcttggctcggtggccaacttttctctgccatggta
gtgcgtaagccggcacatctgttcctagacgagctcggcattgagtacgacgagcaagag
aactacgtggtgatcaagcatgcagcgttgttcacttcaaccatcatgagcaagctcctc
gcccgccccaacgtgaagctattcaacgctgtggcggccgaggacttgatagtaaagaac
aacagggttggtggtgttgtgacaaactgggccttggtgtcaatgaaccatgacacacag
tcatgcatggacccaaatgtgatggaggctaaggttgtggttagttcatgtgggcatgat
gggccgtttggggccacaggggttaagagactcaagagcattgggatgattgatagtgtt
cctgggatgaaggcacttgatatgaatgctgctgaggatgctattgtcaaactcactcgg
gagattgttcctggaatgattgttactggcatggaagttgctgagattgatggtgcccct
agaatgggtccaacatttggggcaatgatgatatctgggcagaaggcagcacatctggct
ttgagagcactgggactcccaaatgctatggactacgctggaaacatctcccaccctgag
cttgtccttgctgctgcacaatctcctcatgttgttgatgcttaa

DBGET integrated database retrieval system