KEGG   Arachis ipaensis: 107631039Help
Entry
107631039         CDS       T04301                                 

Definition
(RefSeq) internal alternative NAD(P)H-ubiquinone oxidoreductase A1, mitochondrial-like
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
aip  Arachis ipaensis
Brite
KEGG Orthology (KO) [BR:aip00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    107631039
Enzymes [BR:aip01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     107631039
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox
Motif
Other DBs
NCBI-GeneID: 107631039
NCBI-ProteinID: XP_016189840
Position
B03
AA seq 553 aa AA seqDB search
MALARIARANLRRSEGAFGNYAPEMNVLSEGRAYTSKFSSTSPYYHVNSKAGDNLSYNPS
IKEQNLMNFSMRGISGTPYYQHPSASTERVLEESDSELEHDEPRYAGLEATKPGEKPRVV
VLGTGWAACRFLKGLDTRIYDVVCISPRNHMVFTPLLASTCVGTLEFRSVAEPVSRIQNA
LSNGPSSYFFLASCTGIDTNKHEVYCEAVNNGGLPREPYQFKVAYDKLVIAAGSEPLTFG
IKGVKENAFFLREVNHAQEIRKRLLLNLMLSENPGISEEEKKRLLHCVVIGGGPTGVEFS
GELSDFIMGDVHKRYTHVKDYIRVTLIEANEILSSFDVSLRKYAIRHLTKSGVHLMKGVV
KEVHPKRVVLSDGTEVPYGLLVWSTGVGPSEFVKTLNLPKSPGGRIGVDEWLRVPSVEDV
FALGDCAGFLEQTERPVLPALAQVAEREGKFLVELFNKMGKQNGGKAFSAKSIPLGDPFV
YTHLGSMASVGGYKALVDLRQSKSSKGVSLAGFVSWLIWRSAYLTRVLSWRNRFYVAVNW
ATTLVFGRDNSKI
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggcattggcaagaattgctagggccaacctgagaagatcagagggtgcttttggcaat
tatgcacctgagatgaacgtactgtctgagggaagagcatacacaagcaaattctcatca
acatcaccttattaccatgtaaattccaaggcaggtgacaatctttcatataatccaagc
attaaggaacagaacttgatgaatttctcaatgaggggaatatcaggaactccttattat
cagcatccttctgccagtacagagagggttctggaggagtccgattcggagctggaacat
gatgagccaagatatgcaggactagaggcaacaaagccaggtgagaagccaagggtggtt
gttcttggaacaggttgggctgcttgcaggttcttgaaagggctagacaccagaatctat
gatgttgtgtgtatatcacctaggaaccatatggtcttcactcctttgctggcttcaaca
tgtgttggaacacttgaattcaggtctgttgctgagcctgtcagcagaatacagaatgcg
ctctcaaatggccccagttcctacttctttctggcttcttgcactggcattgacacaaac
aagcatgaggtgtactgtgaggcagttaataatggtggattacctagggagccttaccag
tttaaagtggcatatgacaagcttgtgattgcagccggatctgagcctttgacttttggt
atcaagggagtgaaggagaatgcatttttccttcgtgaagtaaaccatgctcaagaaatt
cggaagagacttctcctcaaccttatgctttctgaaaatcctggcatatcagaagaagaa
aagaagcgacttttgcattgtgtagttattggtggtggtcctacaggagtggaattcagc
ggtgaattgagtgatttcatcatgggagatgttcataagcgctatactcatgttaaagat
tacattcgtgtcacactcattgaggcaaacgagatattgtcatcctttgatgttagccta
cgaaaatatgctataaggcacttaacaaagagtggggttcatctaatgaagggtgttgtg
aaggaggttcatccaaaaagagtagttctgagtgatggaactgaagttccttatggccta
ttggtatggtccacaggggttggaccttctgagtttgtgaagacactgaaccttcccaag
tctcccggtggaaggattggtgtggatgaatggctgcgtgttccttctgtagaagatgtg
tttgcccttggggattgtgctggttttcttgaacaaactgaaaggcctgtgcttccagct
ctagctcaggtagctgaaagggaagggaagttcctagtggagttattcaacaagatggga
aaacaaaatggagggaaggctttctctgctaagagcatccctcttggagacccttttgtg
tacactcatcttggcagcatggcatcagtaggaggctataaagccctcgttgacctgcgc
cagtcaaagtcttcaaagggggtctcactggctggttttgtcagctggctaatatggcgt
tctgcttacttgacacgtgtactaagctggaggaacaggttttacgtggcagtcaactgg
gcaaccacattggtcttcggcagagacaatagcaagatctaa

DBGET integrated database retrieval system