KEGG   Arachis ipaensis: 107634421Help
Entry
107634421         CDS       T04301                                 

Definition
(RefSeq) palmitoyl-acyl carrier protein thioesterase, chloroplastic-like
  KO
K10781  fatty acyl-ACP thioesterase B [EC:3.1.2.14 3.1.2.21]
Organism
aip  Arachis ipaensis
Pathway
aip00061  Fatty acid biosynthesis
aip01100  Metabolic pathways
aip01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:aip00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    107634421
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:aip01004]
    107634421
Enzymes [BR:aip01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.14  oleoyl-[acyl-carrier-protein] hydrolase
     107634421
    3.1.2.21  dodecanoyl-[acyl-carrier-protein] hydrolase
     107634421
Lipid biosynthesis proteins [BR:aip01004]
 Fatty acid synthase
  Component type
   107634421
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl-ACP_TE 4HBT_2
Motif
Other DBs
NCBI-GeneID: 107634421
NCBI-ProteinID: XP_016193415
Position
B03
AA seq 329 aa AA seqDB search
MVTLSTSSTLCSFIGIMLPQQINFGYRRKFEVKHARCGGFQIKASVKTPNKDDNSLRVTT
SSILDDFVFRQNFTIKSYEVGANEKASIETLMNYFQDSAINHFKTCGIHRGGFGSTKEMI
KRNLIWVFTHMRIEIYRYPVCDEVVQVEAWMSVAGKNAVRWNWLLRDSKTYQVLSKASSG
CVMMNKLTRKLSKIPEEARKEFEFYFVNSSLMILEDDIKNIPKLNVTAADYICTGLKPRW
NDLDINLHVSNVKYIGWVLESVPESILMNHELCGMSLEYKRECGRDSKLHSLTAICGANN
NNVEFYHLLQLEDRGLEILRGRTKWRPKL
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggtaacgctgagtacttcgtctacattatgttcttttattggtatcatgttaccacaa
caaataaattttggctaccgaagaaagtttgaagtgaaacatgctcgttgtggtggcttt
caaattaaggcaagtgttaaaaccccaaacaaggatgataattctttgagagttaccaca
tcttctattctggatgattttgtgttccgtcaaaatttcactattaaatcgtatgaagtt
ggtgctaatgaaaaggcatctattgagactttgatgaactattttcaggactctgcaatt
aatcactttaagacatgtggaattcatcgcggtggctttggttccacaaaagaaatgatt
aaaaggaacttaatatgggtatttactcatatgcgaatagagatttatcgttatcctgtc
tgcgatgaagttgttcaagtggaagcttggatgtccgtagctggaaaaaatgctgtgcgt
tggaattggcttttgcgagattccaaaacatatcaagtcttaagtaaagcctccagtggt
tgtgtcatgatgaacaaactgacaagaaaactatcaaaaataccagaagaagccagaaag
gagtttgagttctattttgtaaattcttctctgatgattctagaagatgatatcaaaaac
atacccaaactcaatgtcactgcagcagattacatttgtaccggtttaaaaccaagatgg
aatgatctagatataaatcttcatgtcagcaatgtgaagtacattggttgggttctggag
agtgttccggaatcaatattgatgaatcatgagttgtgtggcatgagtttggaatacaag
agggagtgtggtagagatagtaagcttcactctctaactgcaatttgtggcgccaataac
aacaatgttgagttttatcatttgcttcaacttgaagatcgtggtcttgagattttaagg
ggaaggactaagtggagaccaaaactttga

DBGET integrated database retrieval system