KEGG   Arachis ipaensis: 107638634Help
Entry
107638634         CDS       T04301                                 

Definition
(RefSeq) dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex 1, mitochondrial isoform X1
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
aip  Arachis ipaensis
Pathway
aip00020  Citrate cycle (TCA cycle)
aip00310  Lysine degradation
aip00380  Tryptophan metabolism
aip01100  Metabolic pathways
aip01110  Biosynthesis of secondary metabolites
aip01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aip00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    107638634
  09105 Amino acid metabolism
   00310 Lysine degradation
    107638634
   00380 Tryptophan metabolism
    107638634
Enzymes [BR:aip01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     107638634
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 PYNP_C RnfC_N HlyD_D23 GCV_H
Motif
Other DBs
NCBI-GeneID: 107638634
NCBI-ProteinID: XP_016197473
Position
B04
AA seq 509 aa AA seqDB search
MNEAPFIFKRCRSFSLFSVLFCSVLFFTIQKNIVIMWPTIIRRKLATNAFSTPSVLKQAL
QGPPPPNSPRYATIAKRLVLLGRGSNIVNIAGRQGCPGYPAHVKHIRGVQVSFPLSMWTR
LYSSENGDLADAVVPFMGESISDGTLAKFLKKPGDRVEVDEPIAQIETDKVTIDVNSPEA
GIIQKLVAKEGDVVQPGIKIAVISKSGEGVAHVASSEKVTSKPPPESSPAEKKTVTEELP
KAKPSSPKASSRPSSATDAQAAQPSKSSVKEPQLPPKERERRVPMTRLRKRVATRLKDAQ
NTFAMLTTFNEVDMTNLMKLRADYKDAFFERHGVKLGLMSGFVKAAVSALQHQPVINGVI
DGDDIIYRDYIDISIAVGTSKGLVVPVLREADKLNFADIEKQINMLAKKANDGTISIDEM
AGGTFTISNGGVYGSLLSTPIINPPQSAILGMHSIVNRPMVVGGEVVPRSMMYIALTYDH
RLIDGREAVFFLRRIKDVVEDPRRLLIDV
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagccccattcatattcaaaaggtgtcgttcattctctctcttctctgttctg
ttctgttctgttctgttcttcaccattcaaaaaaacattgtgatcatgtggccaaccatc
atcaggcgcaaacttgctactaatgctttctccacaccctcggttttgaagcaggcactg
caggggcctcctcctcctaactcgccacgttatgccaccatagcaaaaaggttggtgctt
cttggaagaggatcaaacattgttaacattgctggtcgccaaggttgccctggttatcca
gctcatgtcaaacatatcaggggtgttcaagtatcttttcctctgtccatgtggactagg
ctttactcttcagaaaatggagatttggctgatgctgttgtgccctttatgggtgaatcc
attagtgatggcactcttgcaaaattcttgaagaagcctggtgatcgcgtcgaagttgat
gagccaattgcacaaatagaaacagataaggtgaccattgatgtgaatagtcctgaggct
ggcataatacagaagcttgttgccaaagaaggcgatgttgttcaacctggtatcaagata
gctgtaatttcaaaatctggtgaaggtgttgctcatgtagcctcatctgaaaaagtaact
agcaagccacctcctgagtcatctccggcagaaaagaaaactgttactgaggaacttccc
aaggctaagccctcttctcccaaagcctcatcccgtccatcatccgcgacagatgcacag
gcagcacagccttctaaatcctcagtgaaggaacctcaacttccccccaaggaaagggaa
agaagagttcctatgacaagactcaggaaacgtgtggcgacgcgtttgaaggatgcacag
aacacttttgccatgctgacaacgtttaatgaagttgatatgactaatttgatgaagctt
cgtgctgactacaaggatgcctttttcgagagacatggtgtgaagttaggacttatgtct
ggatttgttaaggctgctgttagtgcactccagcaccaaccagttatcaacggtgtaatt
gatggagatgacatcatctatagagattatattgacattagtattgcagttggtacatca
aagggtcttgttgttccggtattacgcgaagctgataaattgaattttgctgacattgag
aagcaaatcaacatgcttgcaaagaaggcaaacgatggtaccatatcaattgatgaaatg
gctggaggtacattcaccatatcaaatggtggcgtttatggaagccttttaagtacccca
atcatcaacccccctcagtcagcaatacttggtatgcactctatagtgaaccgcccaatg
gttgttgggggtgaagtagttccaagatcaatgatgtacattgcacttacatatgatcat
cgactgatcgatggaagagaggccgtctttttcttgcgccgcatcaaagatgttgtggag
gaccctcgaagattgttgattgatgtatga

DBGET integrated database retrieval system