KEGG   Arachis ipaensis: 107638635Help
Entry
107638635         CDS       T04301                                 

Definition
(RefSeq) aminomethyltransferase, mitochondrial
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
aip  Arachis ipaensis
Pathway
aip00260  Glycine, serine and threonine metabolism
aip00630  Glyoxylate and dicarboxylate metabolism
aip00670  One carbon pool by folate
aip01100  Metabolic pathways
aip01110  Biosynthesis of secondary metabolites
aip01200  Carbon metabolism
Module
aip_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:aip00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    107638635
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    107638635
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    107638635
Enzymes [BR:aip01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     107638635
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GCV_T GCV_T_C
Motif
Other DBs
NCBI-GeneID: 107638635
NCBI-ProteinID: XP_016197474
Position
B04
AA seq 407 aa AA seqDB search
MRGGLWQLGQSITRRLGHGDKKAVARRFFASEAELKKTVLYDFHIANSGKMVPFAGWSMP
IQYKDSIMDSTINCRENGSLFDVSHMCGLSLKGKDSVPFLEKLVIADVAGLAPGTGSLTV
FTNEKGGAIDDSVITKVKDDHIYLVVNAGCRDKDLAHIEEHMKAFKAKGGDVSWHIHDER
SLLALQGPLAAPVLQHLTKEDLSKLYFGMFTVIDINGSQCFLTRTGYTGEDGFEISVPSE
NAVDLAKAILEKSEGKIRLTGLGARDSLRLEAGLCLYGNDMEQHITPVEAGLTWAIGKRR
RAEGGFLGAQFILKQLEEGPKIRRVGFFSTGPPPRSHSEIQDEGGNNIGEITSGGFSPCL
KKNIAMGYVKSGLHKAGTKVKIIIRGKANEGVVTKMPFVPTKYYKPS
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgagggggggattgtggcagcttgggcaatcaatcacccgccgacttggccatggtgat
aagaaggctgttgctcgtcgatttttcgcctctgaagctgaactgaaaaagacagttctg
tatgatttccatatcgctaatagtgggaagatggtgccatttgctggatggagcatgcca
atccaatacaaggattcaatcatggactcaacaataaactgtagagagaatggcagcctt
ttcgatgtttcccatatgtgtgggctaagcctgaagggaaaggactctgttccattcctt
gaaaagcttgtcattgctgatgttgctgggcttgccccgggaactggatctttgactgtt
ttcacaaatgagaaaggaggggcgatcgacgactcggtgattaccaaggtgaaggatgat
cacatatacttggttgtgaatgctggctgtagagataaggatctggctcatattgaggag
catatgaaggcattcaaggccaaaggtggtgatgtttcgtggcacatccatgatgagaga
tcccttcttgctctgcagggtcctcttgctgctcctgttcttcaacatctgacaaaagag
gatttgagcaagctgtactttgggatgttcactgtgatagacatcaatggctcacagtgt
tttctcacccgcacagggtatactggggaagatggttttgagatctcagttccttctgag
aatgcagtcgatcttgccaaggcaatcctggaaaaatccgaagggaaaataagactgacc
ggattgggtgcccgagacagtctgcgacttgaagccggattatgtctgtatggtaatgac
atggagcaacacattacacctgttgaggcaggactcacatgggccattggtaagagaaga
agagctgagggtggttttcttggagctcagtttatactgaaacagcttgaggaaggtcct
aagatcagacgtgttggtttcttttctactggaccaccgcctagaagccacagcgagatt
caagatgaaggtggcaacaacatcggagaaatcaccagtggtggattcagcccttgcctc
aagaagaacatagcgatgggatatgtgaaatcaggattgcacaaggcaggaaccaaagta
aagatcattatccgagggaaagccaatgaaggggttgttacaaaaatgccttttgtacca
accaaatactacaagccctcctaa

DBGET integrated database retrieval system