KEGG   Arachis ipaensis: 107643036Help
Entry
107643036         CDS       T04301                                 

Definition
(RefSeq) acid beta-fructofuranosidase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
aip  Arachis ipaensis
Pathway
aip00052  Galactose metabolism
aip00500  Starch and sucrose metabolism
aip01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aip00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    107643036
   00500 Starch and sucrose metabolism
    107643036
Enzymes [BR:aip01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     107643036
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF3357
Motif
Other DBs
NCBI-GeneID: 107643036
NCBI-ProteinID: XP_016202055
Position
B05
AA seq 669 aa AA seqDB search
MGTSTNNNDSSNDIPCSYIPVPDSLDAAEAMAEPRRQVKGLLVIFCGLLVLFSLVAFNGS
YRGSNNAHEQASLATALTSIVDEKSTSSETVPSSLTWQQAVSRGVSAGVSEKSNRLFSSN
NGEMYPWNNSMLSWQRTAFHFQPEKNWMNDPNGPLYYKGWYHFFYQYNPNAAVWGDIVWG
HAISRDLIHWQHLPLAMVADQWYDKNGVWTGSATILPNGKIIMLYTGSTNESVQVQNLAY
PADPSDPLLIDWVKYPSNPVLFPPPGIGATDFRDPTTAWLTSQGKWRITIGSKLNKTGIA
LVYDTLDFKTYEQIEGFLRAVPTTGMWECVDFFPVSKEVENGLNTSVNGAGVKHVMKVSL
DDDRHDYYAIGSYDEKNVKFIPDDVDNDVGVGLRYDYGVFYASKTFFDDSKRRRVLWGWI
GESDAEYADVAKGWASLQGIPRTVALDTKTGSNLIQWPVAEVESLRLRSDEFKDLKAKPG
SVVPIDVGTATQLDIVAEFEIEKEELEKATSESNVDYYSCESSGGAAKRGALGPFGLLVL
ADDGLSEYTPVYFYVVKGSDGNLKTSFCSDQSRSSVASDVVKKTFGSLVPVLEGEKFSVR
ILVDHSIVESFAQGGRTTVTSRVYPTRAIYGAARLFFFNNATAASVTASLKVWQMNSAFI
RPYNPDQTN
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgggaacttctactaataataacgactcttctaatgatattccatgttcttacataccc
gtgccggatagcctcgatgcggctgaggctatggcggaaccgcggagacaggtgaagggg
ttgcttgtgattttttgtgggcttttagtacttttttcgttggtggccttcaatgggtct
tataggggatccaataatgcccatgaacaagcgtcattggcaacagcattaacaagcatt
gttgatgaaaaatctacatcatcagaaacagtaccttcttctttaacatggcagcaagca
gtgtctcgcggtgtgtctgctggtgtgtcagagaagtccaacaggctattcagcagcaac
aatggtgaaatgtatccgtggaacaatagcatgttatcgtggcagagaacagcttttcat
tttcagcctgagaagaattggatgaacgatcctaatggtccactatactacaagggatgg
tatcacttcttctaccagtacaatccaaacgcagccgtatggggagacatagtttgggga
cacgccatctcaagggacttgattcactggcaacaccttccacttgctatggttgctgac
caatggtacgacaagaacggcgtttggaccggctccgccaccatcttacccaacggcaaa
atcatcatgttgtacactggttccaccaacgagtcagtgcaggttcaaaaccttgcatac
cctgctgatccatctgatcccctcctcattgattgggtcaagtacccttccaaccctgtc
ttgttccctccacctggcattggtgccactgactttcgtgacccaactaccgcttggctt
acctcccaaggcaagtggcgtatcaccattggatccaagcttaacaaaactggcattgct
ttggtttatgacaccctggacttcaagacctacgagcagatagagggcttccttcgtgct
gttcctacaaccggcatgtgggagtgtgttgactttttccctgtttccaaggaggttgag
aatggcttgaacacttctgttaatggggcgggtgtgaagcatgtcatgaaggttagttta
gatgatgacaggcatgattactatgcaattggcagctatgatgagaagaatgtcaagttc
ataccagatgatgttgacaacgatgttggtgttggattgaggtatgattatggtgtgttc
tatgcgtccaaaactttctttgatgatagcaagagaaggagagtgttgtggggttggatt
ggagagtctgatgctgaatatgctgatgttgccaaaggctgggcttcacttcagggtatt
ccgagaacagtggcacttgatacgaaaacaggtagcaacttaattcaatggcctgttgcg
gaggtggagagcttgagactgagaagcgatgagtttaaggatttgaaggcaaagccagga
tccgtggtcccaatagatgttgggacagctacacagcttgatattgtagctgaatttgag
attgaaaaggaagagttggagaaggcaacaagcgagtctaatgtggactattacagttgc
gagagcagcggtggagcagcaaagcgtggtgccttgggaccttttggtcttttggttctt
gcagatgatgggctttctgagtacactccagtgtacttctatgtggttaaaggaagtgat
ggaaatctcaagacttcattctgctccgatcagtcaaggtcgtctgtggcaagcgatgta
gtaaagaaaacatttggaagcttggttccagtacttgaaggtgaaaagttttctgtgagg
atattggtggaccattcaatagtggaaagctttgcgcaaggtggaaggaccacggtgaca
tcaagggtgtacccaacaagggcaatctatggagctgctaggttgttcttcttcaataat
gcaactgctgcttctgttactgcttcactcaaagtttggcagatgaattctgcattcata
agaccttacaaccctgaccagaccaactag

DBGET integrated database retrieval system