KEGG   Arachis ipaensis: 107644533Help
Entry
107644533         CDS       T04301                                 

Definition
(RefSeq) sirohydrochlorin ferrochelatase, chloroplastic isoform X1
  KO
K03794  sirohydrochlorin ferrochelatase [EC:4.99.1.4]
Organism
aip  Arachis ipaensis
Pathway
aip00860  Porphyrin and chlorophyll metabolism
aip01100  Metabolic pathways
aip01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aip00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    107644533
Enzymes [BR:aip01000]
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     107644533
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CbiX CbiK
Motif
Other DBs
NCBI-GeneID: 107644533
NCBI-ProteinID: XP_016203899
Position
B05
AA seq 200 aa AA seqDB search
MKSLSLPSLPFTRLSASERGTNTRWVSFKTSNLSAKTPTLSRVLCLRAKSYVGVGDGDAV
IIVDHGSRRKESNLLLNEFVEMFKHKTGYEIVEPAHMELAEPSIRDAFQSCVEQGAQRVV
ISPFFLSPGRHWNQDIPSLSSEAAKEHPGVSYIVTAPLGLHELLVDVVNDRIKHCLKHIS
GDADECSVCAGTGKCRLYNS
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctctttcacttccttcccttcccttcacaagactttctgcaagtgaaagagga
acaaacacgagatgggtatccttcaaaacctcaaatttgtcagcaaagactccaacttta
agcagagtactgtgtctgagagctaaaagctatgttggggttggtgatggtgatgcagtc
ataattgtggatcatgggtcgcgtcgcaaagagtccaatctcttacttaatgaatttgtg
gagatgtttaaacataaaactgggtacgagattgtggagcctgctcatatggaattagca
gaaccatcaattagagatgcctttcaatcttgtgtcgaacaaggtgcacaacgtgtcgtt
atcagcccctttttcctctctcccggaaggcactggaatcaggacattccttcgttaagt
tccgaggccgcaaaggagcatcctggcgtgtcatacattgtaaccgcaccccttggactg
catgagctacttgtggatgttgtgaatgataggatcaagcattgcttgaagcacatatcc
ggagatgccgatgagtgttctgtttgtgctgggactggaaaatgcaggctttataattca
tga

DBGET integrated database retrieval system