KEGG   Arachis ipaensis: 107644848Help
Entry
107644848         CDS       T04301                                 

Definition
(RefSeq) tripeptidyl-peptidase 2 isoform X1
  KO
K01280  tripeptidyl-peptidase II [EC:3.4.14.10]
Organism
aip  Arachis ipaensis
Brite
KEGG Orthology (KO) [BR:aip00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:aip01002]
    107644848
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:aip03110]
    107644848
Enzymes [BR:aip01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.10  tripeptidyl-peptidase II
     107644848
Peptidases and inhibitors [BR:aip01002]
 Serine peptidases
  Family S8: subtilisin family
   107644848
Chaperones and folding catalysts [BR:aip03110]
 Intramolecular chaperones
  Subtilisin family
   107644848
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 TPPII Prp19 Skp1
Motif
Other DBs
NCBI-GeneID: 107644848
NCBI-ProteinID: XP_016204271
Position
B05
AA seq 1318 aa AA seqDB search
MPCSSIITPQHNDDDDASSDFKLNESTFLASLMPKKEIAVDRFLQDHPNYDGRGVLIAIF
DSGVDPAAAGLQVTSDGKPKILDVIDCSGSGDVDTSKVVKADADGCICGASGASLIINTS
WKNPSGEWHIGYKFVYELFTEELTSRLKKERKKKWDEKNQEEIAKAVKQLQDFDQQHIKV
EDAQLKRAREDLQNRLDLLKRQSESYDDKGPVVDAVVWHDGEVWRVALDTHSLEDDPDCG
KLSNFVPLTNYRIERKYGVFSKLDACTFVVNVYNNGNVLSIVTDCSSHATHVAGIASAFH
PKEPLLNGVAPGAQLISCKIGDSRLGSMETGTGLIRALIAAVEHKCDLINMSYGEPTLLP
DYGRFVDLVNEVVNKHRLIFVSSAGNSGPGLSTVGAPGGTSSSIIGIGAYVSPAMAAGAH
CLVEPPSEGLEYTWSSRGPTADGDLGVCVSAPGGAVAPVPTWTLQRRMLMNGTSMASPSA
CGGTALLISAMKAEGISVSPYTVRRALENTAVPIGDLPEDKLSTGQGLMQVDKAFEYIKK
CQNFPCVRYQINIQQSGKTYPSSRGIYLREASVCRQSTEWIVQLDAKFHEDASNFEDLVP
FEECIELRSTEPAVVKVPDYLLLIHNGRTFNVVVDPSNLGDGLHYYEVYGIDCKAPWRGP
IFRIPITITKPHAVTSQPPRVSFSKMIFQPGHIERRYVEVPHGASWVEATMKTSGFDTAR
KFYVDAVQICPLQRPLSWEKVVSFPSPATKTFAFKVVSGQTLELVISQFWSSGIGSDETA
IVDFEVVFHGIKVNKEEVTLDGSEGPLRIDAETLLASEELTPTAALNKIRVPYRPVDSKI
SALSTDRDKLPSGKQILALILTYKIKLEDGAEVKPHIPLLNGRIYDNKFESQFYVISDLN
KRVYSTGDVYPSSSKLPKGEYNLQLYLRHDNVQILEKIRNLELFIEQNLGDKEIIQLSFF
SQPDGPVIGNGSFKSSFLFPGIKEGFYLGPPPKDKLPKNSTQGSVLLGAISYGKLSFSEG
ENKNPEKHPASYQLSYVVPPNKIEEDKGKGSSKSSKKTVSERLTEEVREAKIHVLGSLKQ
ETDEERSQWEELAASLKSEYPKYTPLLAKILEGLVSRTDVEDKIGHDEKVIDAANEVIDS
IDREELAKFFALKNDPEDEAEDIRKKMETTRDQLAEALYQKGLALAEIESLKLADLTTWC
ILSKEGDTEGAKKDEDKSGDQSTHDPDLFEENFRELKKWVDVKTPKYGILLVTREKRAQR
LGTALKALLDLIHDDPEPAKKKFYELKLSLVEEIGWTHWATYEREWMLVRFPPTLPLF
NT seq 3957 nt NT seq  +upstreamnt  +downstreamnt
atgccttgttcttcaataatcactcctcaacataacgatgatgatgatgcttcctccgat
ttcaagctgaacgagtcaaccttcttggcctcactcatgcctaagaaggagattgccgtc
gatcgattcctccaagatcatcctaactacgatggccgcggtgttctcatcgccatcttc
gattctggtgtagacccggccgctgctggattgcaggttacctcagatgggaaacccaaa
attcttgatgtcattgattgttctggcagtggagatgttgatacctcaaaggtggtgaag
gctgatgctgatggttgtatttgcggtgcatcaggggcatctttgatcatcaatacttca
tggaaaaatccttctggtgaatggcatattggttacaaatttgtttatgagctttttaca
gaagaattgacttctcgtttgaagaaagaaagaaagaaaaagtgggacgagaaaaaccag
gaggaaattgctaaggctgtaaaacagcttcaagattttgatcagcaacatatcaaggtg
gaggatgcacaacttaaaagggctcgggaagatctccagaataggcttgatcttctgaaa
aggcaatctgagagctacgatgataaaggacctgttgtagatgctgttgtatggcatgat
ggagaggtctggagggttgctcttgacacacacagtcttgaggatgatccagactgtggg
aagctttctaactttgtacccttaactaattataggattgagaggaagtatggtgtcttc
agcaaattggatgcttgtacatttgttgttaacgtctataacaatggaaatgtgttaagt
attgtaacagactgctcatcccatgccacccatgtagctggtattgcttctgctttccac
ccaaaggagcccttgttaaatggagttgcacccggtgcacaattaatatcttgtaaaatt
ggggattctcgcttaggttcaatggaaactggcacaggtttgattcgagcattgatagct
gctgttgagcacaagtgtgatcttatcaacatgagttatggtgaaccaacattactgcct
gattatggacgctttgttgaccttgtgaatgaagtggtgaacaagcatcgtctgatattt
gtgagcagtgctggtaatagtgggccaggtctgagcactgttggtgcacctggtggtaca
tcttcaagtatcataggtattggtgcatatgtttctcctgcaatggctgcaggtgcccat
tgtcttgtcgaacctccatctgaggggcttgaatacacttggtctagccgagggccaaca
gctgatggagaccttggggtgtgtgtgagcgcccctggtggtgctgttgctcctgttcct
acttggactcttcaacgacgtatgctcatgaatgggacatcaatggcatctccgtcagct
tgtggaggaactgcattgctcataagtgcaatgaaggctgagggaatttctgtgagtcca
tataccgttaggagagcccttgagaacacagctgttcccataggtgatctacctgaggat
aagttatccactggacaaggccttatgcaagttgacaaggcttttgaatatataaagaag
tgtcaaaactttccgtgtgttagatatcaaataaatatccagcaaagtggaaaaacatat
ccttcatcacggggcatctatcttcgggaggctagtgtttgccgacaatctacagagtgg
atagttcaacttgatgcaaaatttcatgaagatgccagcaactttgaggatttggttcca
tttgaggagtgtattgaattgcgttctactgaaccagcagttgtgaaggtccctgactat
ttgctgctcattcataatggccgtaccttcaatgtagttgttgatccttccaatctaggt
gatggtcttcattattatgaggtctatggtattgactgcaaagcaccatggcgtggtcct
atttttagaataccaattaccataaccaagccccatgctgtaactagtcagcctccaaga
gtttcattttcgaagatgatattccagccaggccatattgaaagaagatatgtagaagtg
ccgcacggtgcttcttgggttgaagcaacaatgaaaacttctggtttcgatacggctcga
aaattttatgtggacgctgttcagatatgcccacttcaaagacctctgtcatgggaaaaa
gtggtatcctttccttctcctgccaccaagacctttgcgtttaaggttgtaagcggtcaa
acattggaactagtcatttctcaattttggtcaagtgggatagggagtgatgagactgcc
attgtggatttcgaggttgtatttcacggtataaaagtcaacaaagaagaagtcacactt
gatggtagtgaaggaccactaagaattgatgctgaaacattattggcatcagaggaactt
acaccaacagcagctttaaataagattagggttccatatcgaccagtggattctaagatt
agtgcactttcaacagaccgtgacaaactcccctctggaaagcagatactggcactgatt
ttgacctacaagatcaaattggaagatggagctgaagtaaaacctcatataccattgctc
aatggccggatatatgataataaatttgagtcacaattttatgtcatttctgatttgaac
aagcgtgtatattcaactggtgatgtctatccaagctcttcaaagcttcccaagggagaa
tacaatttacagctatatttgaggcatgacaatgtgcaaattctggaaaagataaggaat
ttggagttattcattgagcaaaatttgggagacaaggaaatcattcagctatcctttttc
tctcaacctgatggcccagtgattggaaatggctcctttaaatcgtcattcttatttcca
ggtataaaagaaggattttatctgggtccaccaccgaaagataagcttcccaagaattct
acacaaggttctgtattgttaggggcaatttcgtatgggaaactgtcattttctgagggg
gagaataaaaatccagaaaagcaccctgcatcatatcaactatcttacgtagtgccccca
aataagattgaagaagacaagggaaaaggttcttccaaatcttccaagaagactgtttct
gaacgtttgacagaagaggtaagagaggcaaaaatacatgtgctaggaagccttaagcaa
gaaactgatgaagagcgctcacagtgggaagagctagctgcctctcttaaatcagaatat
ccaaaatacactccactgcttgcaaagattttggaaggtttagtttctaggactgatgtc
gaggacaaaattggtcatgacgaaaaggtgattgatgcagcaaatgaggtgattgacagt
atagacagggaagaattagcaaaattttttgcactgaaaaatgatccagaagatgaagca
gaggatatcaggaaaaagatggaaacaacccgtgaccagttagcagaggcattgtatcag
aaggggcttgcgctggcagaaatagagtctttaaagttggcagacttgacgacttggtgt
atattgtcaaaggagggagatacagaaggtgcaaagaaagacgaggacaagagtggtgac
caatctacacatgatccagacttgtttgaagagaattttagagaattgaagaaatgggtt
gatgtcaagaccccaaaatatggaatcctgttagtaacacgcgagaagcgtgctcaaagg
cttggtacagcattgaaggcactcttggacctaattcacgatgatccagagcctgctaag
aagaaattctatgaactgaagctgtctttggttgaagagattggatggacacattgggca
acatatgaaagagagtggatgcttgtgcgtttccctccaaccttgcccctcttctaa

DBGET integrated database retrieval system