KEGG   Arachis ipaensis: 107645356Help
Entry
107645356         CDS       T04301                                 

Definition
(RefSeq) probable glutathione peroxidase 5
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
aip  Arachis ipaensis
Pathway
aip00480  Glutathione metabolism
aip00590  Arachidonic acid metabolism
aip01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aip00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    107645356
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107645356
Enzymes [BR:aip01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     107645356
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 107645356
NCBI-ProteinID: XP_016204851
Position
B06
AA seq 170 aa AA seqDB search
MGASNSVSEKSIFEFTVKDAKGRDVSLSTYKGKVLLVVNVASKCGFTDTNYTQLTELYSK
YKDKGLEILAFPCNQFLKQEPGSSEDAEQFACTRYKAEYPIFGKVRVNGSSAAPVFKFLK
SRKSGFLGSRIKWNFTKFLIDKEGDVIQRYGPTTEPLAIEDEIKKALGEA
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggagcttcaaattcagtttcggaaaaatccatctttgaattcactgttaaggatgcc
aagggaagagatgtgagcctcagcacttacaagggcaaagttcttcttgtagtcaacgtc
gcttcaaaatgtggattcacggacaccaattacacccagttaactgagctttacagcaaa
tacaaggataaaggtctagagatactggcatttccatgcaaccaatttttgaagcaagag
cctgggtctagtgaagatgcagagcaatttgcctgtacaagatacaaggctgaatatccc
attttcggaaaggtccgcgtgaatggatcaagtgcagcacctgtcttcaaatttcttaag
tcccgtaaatctggatttctggggtctaggataaagtggaatttcactaagtttttgatt
gataaggaaggggatgtcatccagcgatacggtccaaccactgaaccattggcaattgaa
gatgagatcaagaaggcattgggggaggcctga

DBGET integrated database retrieval system