KEGG   Arachis ipaensis: 107647436Help
Entry
107647436         CDS       T04301                                 

Definition
(RefSeq) protein LYK2
Organism
aip  Arachis ipaensis
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr LysM INSIG Kinase-like
Motif
Other DBs
NCBI-GeneID: 107647436
NCBI-ProteinID: XP_016206996
Position
B06
AA seq 668 aa AA seqDB search
MIMTFLHMKALICFFFFVFVPTSGNDLLSCETTSPDASGYSCIQNNKSSIQCATFALIHT
NPYFSSLSNLTHYLGLNRFVIAKSNGFSPENTEILSNDQPLLIPIDCKCSKHGFFYAELT
KTTIKGESFHGIAESLEGLTTCKAIKDRNPGVSPSNLDGEFKLLIPLRCACPVSSSQEQR
ALLSYPVSKGDTVSNLASKFNVTIESIISTNNLSSSEGFETQSLTPFTCLLIPLLNNNPV
AKPSNNPVISPHKKTKMWRTELCIGLAGVALGLFIASLVGFFFIRLKNKKQSVKNNNKCK
ELDMELQHLNLSVRTTSDKKVSFEVPHEGKILEAATPRKMFLETYTREEIRNATEDFSSS
NHIEGPVFHGRLNGKNIAIKRTTNDVVSKIEFGLFHHSVQRHPNILMLLGTTSLLEGPDS
YLVFEYAKNGSLKDWLHGGLAIKNQFIASCYCFLTWRQRLRICLDIAGALQYMHHVMIPS
YVHRNIKSRNIFLDEEFGAKLGNFGMAMCAENETEDPHFYSTNPASWSLGYLAPEFVHQG
VVSPSIDVFAYGVVLLEVLSGQTPISRPNDKGEGSVWLTDKIRSILASEKNASELREWVD
SALGENYSFDAAFELANIARACVEDEASLRPSANEIVDKISRLVEEFPDGEHHMLITESS
SKPLVNAV
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgatcatgaccttcttacacatgaaagcattgatctgtttcttcttctttgtgtttgtc
cccacatcggggaatgacctcttaagctgtgagacaacttcaccagatgcatctggctac
agctgcatacaaaataataaaagctctattcaatgtgcaacatttgcactcattcacaca
aatccatacttttcttctctctcaaacctcactcattacttgggacttaaccgttttgtg
atagcaaaatcaaatggtttctctccagaaaacactgaaatcctctccaatgatcaaccc
cttttaataccaattgattgcaagtgcagcaaacatggttttttctatgctgaattgacc
aaaaccaccatcaaaggtgagagcttccatggcattgctgaatcacttgaaggcttaact
acctgcaaggccataaaagatcgaaaccccggcgtgtcgccttcgaatctcgacggagaa
ttcaagttgctgattccattaagatgtgcatgcccagtttcatcttctcaagaacaaagg
gctctgctttcttatcctgtaagtaaaggcgacacggtttcgaatttggcttcaaagttt
aatgttaccatagaatccataatttctacaaataatttatcatcatcagaagggtttgaa
actcaaagccttacaccttttacatgtcttctgattccattgttaaataataatcctgtg
gctaaaccctctaataatcctgtgattagtccacataagaaaacaaaaatgtggaggact
gaactgtgtattggcctagccggtgttgcacttggactcttcattgcttcgttagtggga
ttctttttcatcagattgaagaacaagaagcagagtgtgaagaacaataataagtgtaaa
gagttagatatggagcttcaacatctgaatctcagtgtaagaacaaccagtgacaaaaaa
gtctcattcgaggtacctcacgaggggaagatcctagaagctgcgacgcctcgaaagatg
ttccttgagacatacacaagggaggaaattcggaacgcaacagaagacttcagctcaagc
aatcacattgaggggccggtgttccatggccgattgaacggcaagaacatagcaataaaa
agaacaacgaacgatgtcgtttcgaagatagagttcggcctcttccaccactcagttcaa
cgtcaccccaacattctaatgcttcttggaacaacaagcttgctagagggtccagattcc
tacctggttttcgagtatgcgaaaaacggatccttgaaagactggcttcacggtggcttg
gcaatcaagaatcagttcattgcttcatgctattgtttcttgacgtggaggcagaggctc
cggatctgcctcgacatagccggcgccttgcagtacatgcaccatgtgatgatcccaagc
tatgttcataggaacataaagagtaggaacattttcttggatgaagagtttggcgcaaaa
cttgggaatttcggtatggcaatgtgtgctgagaatgaaactgaagatccacatttctat
tccacaaaccctgcttcttggagccttggttatttggcacctgaatttgttcatcaaggt
gtagtttcaccaagcattgatgtgtttgcttatggggtggttttgttggaggttttgtcc
ggccaaacacccataagcaggcctaatgacaagggtgaagggagtgtttggctcacggat
aaaatccggtcgattttggcgtcggagaagaatgcaagtgagctgagggagtgggttgat
agtgccttaggggagaactattcgttcgatgcagctttcgaattggctaacattgcaagg
gcttgtgttgaagatgaggcttctttgagaccaagtgcaaatgaaattgttgacaagatt
tcaagattggtggaggagtttccggatggggaacaccacatgttaatcaccgaaagctct
agcaagccattggttaatgctgtatga

DBGET integrated database retrieval system