KEGG   Arachis ipaensis: 107647850Help
Entry
107647850         CDS       T04301                                 

Definition
(RefSeq) tyrosine decarboxylase 1 isoform X1
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
aip  Arachis ipaensis
Pathway
aip00350  Tyrosine metabolism
aip00360  Phenylalanine metabolism
aip00380  Tryptophan metabolism
aip00950  Isoquinoline alkaloid biosynthesis
aip00965  Betalain biosynthesis
aip01100  Metabolic pathways
aip01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aip00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    107647850
   00360 Phenylalanine metabolism
    107647850
   00380 Tryptophan metabolism
    107647850
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    107647850
   00950 Isoquinoline alkaloid biosynthesis
    107647850
   00965 Betalain biosynthesis
    107647850
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aip04147]
    107647850
Enzymes [BR:aip01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     107647850
    4.1.1.105  L-tryptophan decarboxylase
     107647850
Exosome [BR:aip04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107647850
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-GeneID: 107647850
NCBI-ProteinID: XP_016207377
Position
B06
AA seq 492 aa AA seqDB search
MEGEQQSSGILRSMDAEQLREHAHKMVDFIADYYKTIESFPVLSQVQPGYLEKLLPDSAP
DYPETLEHVLNDVQEKILPGVTHWQSPNYFAYFPSNSSIAGFLGEMLSAGFNIVGFSWIT
SPAATELETIVLDWLAKALKLPHDFHSTGQGGGVIQGTASEAVLVVLLAARDKILRTVGK
GALPKLVTYASDQTHSSLLKACQIGGLNPEFCRSLKTDASTNYALSPEVFSEAVSRDIAS
GLIPFFLCATVGTTSSTAIDPLPELGKIAKVKNIWFHVDAAYAGSACVCPEYQHHLNGVD
EADSFNMNAHKWLLTNFDCSLLWVKDRSALIQSLSTNPEYLKNKASQGNMVIDYKDWQIP
LGRRFRSLKLWMVMRLYGLEGLRNHTRNHINLAAYFEDLVGQDPRFKVVTPRTFSLVCFR
LLPPANTEDTNKLNRDLLDSVNSTGSVFITHTVLSGQFILRFAVGAPLTEQRHVDAAWRI
LQEKATALLGSL
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggaaggagaacaacaaagcagtggcatattgaggtccatggacgcggagcaactcaga
gagcatgcacataagatggttgattttattgctgactactacaaaaccattgagagtttc
ccagttctcagccaagttcagccaggttatcttgaaaagctcttaccggattctgctcct
gattatcctgaaacactggagcatgttttgaatgatgtacaggaaaagattttgccaggg
gtaacacattggcaaagccccaattattttgcatattttccttccaacagtagcattgct
ggatttcttggagaaatgctcagtgctggtttcaacattgtcggtttcagctggataact
tctcctgccgcaacagaactcgaaaccattgttctcgattggcttgctaaggcacttaag
ctgcctcatgatttccattctactgggcaaggtggtggagttattcaaggaacagcgagt
gaagcagttctagttgtcttgttggctgctcgcgacaagatcttaaggacggttggaaaa
ggcgctcttcctaagcttgtgacatatgcatctgatcaaacacactcttctctactaaaa
gcctgccagataggtggacttaatcctgagttttgcaggtcactaaaaactgatgcttca
acaaattatgcgctttctcctgaagtattttctgaagcagtttcaagggacattgctagt
ggtcttataccatttttcttatgtgctaccgttggtacaacttcatcaactgctattgat
cctctacctgaattggggaaaattgctaaggtcaaaaacatttggtttcatgttgatgct
gcttatgctggaagtgcttgtgtatgtccagagtatcaacaccatctcaatggtgtcgac
gaagcagactcattcaacatgaatgcgcataaatggctcttgacaaactttgactgttca
ctactttgggttaaggatagaagtgctctgattcaatcactatctacgaacccggagtat
ctgaaaaacaaggcctctcaaggaaatatggtcatagattacaaagattggcaaattccc
ctggggcgtcgctttagatcgttaaaactgtggatggtgatgcgtctctacggattggaa
ggtctgcgaaatcacacgagaaaccacattaatcttgctgcttattttgaggaccttgtt
ggtcaggatccaaggttcaaggttgttacgcctcgcacgttctctttagtctgttttcgg
cttttgcctccggctaacacagaagatactaataaactgaaccgtgatctacttgactcg
gtgaattcaacaggaagtgttttcataacacacacggttctatcaggtcagttcattctg
cgttttgcagtaggagcaccattgacagaacagaggcatgtcgacgcagcatggcgaatt
ttgcaagaaaaggccactgctctgcttgggagtttgtag

DBGET integrated database retrieval system