KEGG   Arachis ipaensis: 110263214Help
Entry
110263214         CDS       T04301                                 

Definition
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
aip  Arachis ipaensis
Pathway
aip03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:aip00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    110263214
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:aip03041]
    110263214
Enzymes [BR:aip01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     110263214
Spliceosome [BR:aip03041]
 Complex C
  Other components
   Step II factors
    110263214
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PGM1_C CDC45
Motif
Other DBs
NCBI-GeneID: 110263214
NCBI-ProteinID: XP_020959863
Position
B01
AA seq 224 aa AA seqDB search
MAVENPQDSLKKLEYLSLVSKVCTEMESHTGNSDNVLAEFITKLGRSSENVEEFDTKLKE
NGAKLSDYFVRALLTIIHAILPPKKDSGNSDVKGSKQNGGGSKGKFKALAIADDRDRVKE
LHKEIEAEAKEKHGGVRDRQIHDEDGHRGRDRDRRDRRDRRDMYDKYDRDERHRDRNRDR
DRDNDDYDDEKGDSRRRGRNRENDRGRDKDKDRYERRRRDECEE
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggcggtggagaacccacaagattcgttgaagaagctcgagtacttgtctcttgtttcg
aaggtttgcaccgaaatggagtctcacactggaaacagtgacaatgtactcgccgagttc
atcaccaagttgggtcgatcttccgagaacgtcgaagaattcgacacaaaattgaaggag
aacggtgccaaattgtcggactattttgtccgtgcacttctcacgataatccacgctatt
ctccctccgaagaaggattctgggaacagcgacgtcaagggttcgaagcagaacggtggt
ggttcgaaggggaagttcaaggcactggctattgcagatgatagggatagggttaaggag
ctgcataaggagattgaagctgaagccaaagagaaacatggtggtgttagagacagacaa
atacacgatgaagatgggcacagaggaagagacagagatagaagggatagaagagatagg
agggacatgtatgataaatatgatagagatgaaaggcatagagataggaatagagataga
gatagagataacgatgattatgatgatgaaaaaggggattctaggagaaggggaaggaat
agagagaatgataggggtagggataaggataaggatagatatgagaggcggaggagagat
gagtgtgaagaataa

DBGET integrated database retrieval system