KEGG   Arachis ipaensis: 110268439Help
Entry
110268439         CDS       T04301                                 

Definition
(RefSeq) vacuolar protein sorting-associated protein 41 homolog
  KO
K20184  vacuolar protein sorting-associated protein 41
Organism
aip  Arachis ipaensis
Brite
KEGG Orthology (KO) [BR:aip00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aip04131]
    110268439
Membrane trafficking [BR:aip04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    110268439
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 110268439
NCBI-ProteinID: XP_020970251
Position
B10
AA seq 217 aa AA seqDB search
MALVVFFAVCDLLLSYRWNVFDRWVFHFAHLRQLPDLVPYMPTENPRLRDTAYEVALVAL
ATNSSYHKDLLSTVKSWPSVIYSALPVISAIKPQLNTSSMTDSLKEALAELYVIAGQYDK
AFSFYADLMKPELFDFIDKYNLQDSIHEKVVQLMMLDCKRAVPLLIQHRDLISPQEVVKQ
LLNADVKCDCRYFLHLYLHSLFEVNPHCRLPFVWELR
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggcattagtagttttttttgcagtttgtgatttgttattaagttaccgatggaatgta
ttcgacagatgggtatttcattttgcccacctccgtcaactccctgatttggttccttac
atgccaacagaaaaccctagactacgtgatactgcttatgaggttgcccttgtggcattg
gctacaaattcatcttatcataaggatctcttgtccactgtgaaatcatggccatctgta
atttattctgcattacctgtaatttcagccatcaaacctcagctcaatacttcatccatg
accgattcgctcaaggaggcattggcagagttgtatgttattgctgggcaatatgataaa
gcattttcattttatgctgatcttatgaaaccagaactctttgatttcattgataaatat
aacctacaagattcaatccatgaaaaggttgtccaattgatgatgttggattgcaagcgt
gcagttcctttattgatccagcatagggacttaataagtccacaagaagttgtgaagcaa
cttctaaatgctgatgttaagtgtgactgcagatactttttacatttgtatctccattca
ctatttgaagtaaatccgcattgcaggcttccttttgtttgggagctaaggtag

DBGET integrated database retrieval system