KEGG   Achromobacter insolitus: BUW96_02280Help
Entry
BUW96_02280       CDS       T04671                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ais  Achromobacter insolitus
Pathway
ais00071  Fatty acid degradation
ais00072  Synthesis and degradation of ketone bodies
ais00280  Valine, leucine and isoleucine degradation
ais00310  Lysine degradation
ais00362  Benzoate degradation
ais00380  Tryptophan metabolism
ais00620  Pyruvate metabolism
ais00630  Glyoxylate and dicarboxylate metabolism
ais00640  Propanoate metabolism
ais00650  Butanoate metabolism
ais00900  Terpenoid backbone biosynthesis
ais01100  Metabolic pathways
ais01110  Biosynthesis of secondary metabolites
ais01120  Microbial metabolism in diverse environments
ais01130  Biosynthesis of antibiotics
ais01200  Carbon metabolism
ais01212  Fatty acid metabolism
ais02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ais00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BUW96_02280
   00630 Glyoxylate and dicarboxylate metabolism
    BUW96_02280
   00640 Propanoate metabolism
    BUW96_02280
   00650 Butanoate metabolism
    BUW96_02280
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BUW96_02280
   00072 Synthesis and degradation of ketone bodies
    BUW96_02280
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BUW96_02280
   00310 Lysine degradation
    BUW96_02280
   00380 Tryptophan metabolism
    BUW96_02280
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BUW96_02280
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BUW96_02280
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BUW96_02280
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ais04147]
    BUW96_02280
Enzymes [BR:ais01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BUW96_02280
Exosome [BR:ais04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BUW96_02280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: APX73843
Position
511373..512557
Genome map
AA seq 394 aa AA seqDB search
MPNREVVVLSGVRTPIGSFGKSLKDVPPTALAAEVLKAAVARAGLAPAHVEHVCFGQVIT
TEARDLYLSRVAALEAGCADGTPAFNVNRLCGSGLQAVVSAAQSILLGDCSIAVAGGAES
MSRAPYATSALRFGARMGDAPMADMLLGALHDPFHRIHMGVTAENVAKRYGITRDAQDAL
ALESHRRAARAAAEGRFDAQLVAITTPGRKSIVFARDEHVRADIAPPDLAGLMPVFGSEE
GTVTAGNSSGINDGAAALVLMDRAQAQASGARPMARLVAYGHAGVDPRYMGMGPVPAVRA
ALDKAGLSAADMDVIESNEAFAAQACAVARELDLDPAKVNPNGSGIALGHPVGATGAIIA
VKALHELQRIQGRYALVTMCIGGGQGIAVIFERL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaccgagaagttgtagtcctgtcgggcgtgcgcacgcccatcggcagtttcggc
aagagcctgaaggacgtgcctcccaccgcgctggccgccgaggtgctgaaggccgccgtg
gcgcgcgcgggcctcgcacctgcgcatgtggagcacgtctgcttcgggcaggtcatcact
accgaggcgcgcgacctgtatctgtcccgggtcgcggcgctggaggccggctgcgccgat
ggcacgccggcattcaacgtcaaccgcctgtgcggctcgggattgcaggcggtcgtttcc
gcagcgcagtccatcctgcttggcgattgcagtatcgcggtggcgggcggggccgagagc
atgtcgcgcgcgccgtacgccacgtcggcgctgcgttttggcgcgcgcatgggcgatgcg
ccgatggcggacatgctgcttggcgccctgcatgatccatttcatcgcatccacatgggc
gtcacggcggaaaacgtcgccaagcgctatggcattacgcgcgacgcgcaggatgcgctt
gcgctggaaagccatcgccgagccgcgcgggctgcggccgagggacgtttcgacgcgcaa
ctcgtggccattacgacgccgggccgcaaatccatcgtgttcgcccgagacgaacatgtg
cgcgccgatatcgcgccgcccgatcttgccggtctcatgcccgtcttcggttccgaggag
ggcacggtcacggcgggcaattcgtccggcatcaatgacggcgcagcagcgctggtgctg
atggatcgcgcgcaggcgcaagccagtggcgcgcgccccatggcgcggctggtcgcctat
ggccatgcaggcgtggatccgcgctatatgggcatggggccggtgcccgctgtgcgtgcg
gccctggacaaggccggcctgtcggccgccgacatggacgtgatcgagtccaacgaggct
tttgcggcgcaggcatgcgccgtggcgcgcgagctcgatcttgatccggccaaggtcaat
cccaacggctcaggcatcgccttaggacatcccgtgggcgcaaccggcgcgatcatcgcc
gtcaaggccttgcatgagctccagcgtatccagggccggtacgcgctggtcaccatgtgc
atcggcggcgggcagggcattgccgtcatcttcgagcgtctttga

DBGET integrated database retrieval system