KEGG   Achromobacter insolitus: BUW96_02770Help
Entry
BUW96_02770       CDS       T04671                                 

Definition
(GenBank) aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
ais  Achromobacter insolitus
Pathway
ais00051  Fructose and mannose metabolism
ais01100  Metabolic pathways
ais01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ais00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BUW96_02770
Enzymes [BR:ais01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     BUW96_02770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: APX73927
Position
610333..611118
Genome map
AA seq 261 aa AA seqDB search
MSTALREKSYFDTRATQEMARHLHAVPRSIQETMAYACRILAMTEQEAGLAGQISVRSQR
PGAYWTLRFGLGFDEATPADFIEVDRDLHTLTGEGMANPATRFHLWVYEARPDVQSIIHT
HSPWASALAAARQPLVISQMDMTPLHDDCAFLGDWPGVPIADQEGVIISKALGGKRAIIL
AHHGYLTAGGSCEEATYLSVYLERAARMQIRAQAFGPLTPVDDALAREAHDYLLKPSIVN
ATFNYWARQTHGIAPLPLPAA
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgcattacgagagaaatcctatttcgacacccgtgccacgcaggaaatggcg
cgccatctgcacgccgttccgcgcagcatccaggaaaccatggcctatgcctgtcgcatc
ctggccatgaccgagcaggaggccgggctcgccggccagatcagcgtgcgctcgcagcgt
cccggggcgtattggaccctgcgtttcgggttgggctttgatgaagccacgccagccgat
ttcatcgaggtggaccgcgatcttcacacgctgacgggcgagggcatggccaacccggcc
acccgatttcacctgtgggtgtacgaggcccggcccgacgtgcaatccatcatccacacg
cattcgccctgggcctcggcgctggccgcggcgcgccagcccctggtgatttcgcagatg
gacatgacaccgctgcacgacgactgcgcgttcctgggcgattggcccggcgtgccgatc
gcggaccaggaaggggtgatcatctccaaggcgttgggcggcaagcgcgccatcatcctc
gcgcatcacggctatctgaccgccggcggcagctgcgaagaggcgacctacctgtcggtg
tacctggaacgcgcggcgcgcatgcagatccgcgcgcaggcgttcgggccgctgacgccc
gtggacgatgccctcgcgcgcgaagcgcacgactacctgctcaagccttcgatcgtcaac
gcgacgttcaactactgggcccggcagacgcacggcattgcgcccttgccgctgcccgcc
gcctga

DBGET integrated database retrieval system