KEGG   Achromobacter insolitus: BUW96_08015Help
Entry
BUW96_08015       CDS       T04671                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ais  Achromobacter insolitus
Pathway
ais00071  Fatty acid degradation
ais00072  Synthesis and degradation of ketone bodies
ais00280  Valine, leucine and isoleucine degradation
ais00310  Lysine degradation
ais00362  Benzoate degradation
ais00380  Tryptophan metabolism
ais00620  Pyruvate metabolism
ais00630  Glyoxylate and dicarboxylate metabolism
ais00640  Propanoate metabolism
ais00650  Butanoate metabolism
ais00900  Terpenoid backbone biosynthesis
ais01100  Metabolic pathways
ais01110  Biosynthesis of secondary metabolites
ais01120  Microbial metabolism in diverse environments
ais01130  Biosynthesis of antibiotics
ais01200  Carbon metabolism
ais01212  Fatty acid metabolism
ais02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ais00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BUW96_08015
   00630 Glyoxylate and dicarboxylate metabolism
    BUW96_08015
   00640 Propanoate metabolism
    BUW96_08015
   00650 Butanoate metabolism
    BUW96_08015
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BUW96_08015
   00072 Synthesis and degradation of ketone bodies
    BUW96_08015
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BUW96_08015
   00310 Lysine degradation
    BUW96_08015
   00380 Tryptophan metabolism
    BUW96_08015
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BUW96_08015
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BUW96_08015
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BUW96_08015
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ais04147]
    BUW96_08015
Enzymes [BR:ais01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BUW96_08015
Exosome [BR:ais04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BUW96_08015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: APX74822
Position
1774099..1775280
Genome map
AA seq 393 aa AA seqDB search
MREAVIVSTARTPITKAGRGEFNLIAGPTLAAHAVRAAVDRAGIDPALIEDAFIGCGYPE
GATGRNVGRQAVIRAGLPVTVGGATINRYCASGLQAIASAASRIVMDGAPAMIAGGVELV
SQIRTRDDGVSGMDPWIVANKPELYLPMIETADIVAARYGISREAQDRYAAQSQARTEAA
QAAGRYQEEIIPVTTTMSVTDRATGAVSEREVTVDRDTCNRPGTTYDALASLAPVRGAGQ
FVTAGNASQLSDGAAACVLMEASEAQRAGIRPLGAFRGLAIAGCEPDEMGIGPVYAVPKL
LARHGLKVQDIDLWELNEAFASQALYCQEKLGIPMDRLNVDGGAIALGHPFGVTGARLAG
HVLIEGRRRGARYAVVTMCVGGGMGAAGLFEIY
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgaagccgtcatcgtctccactgcccgcacgcccatcaccaaggccggacggggc
gaattcaacctgatcgccggccccacattggccgcgcatgcggtgcgcgccgccgtcgac
cgcgccggcatcgaccccgccctgatcgaggacgccttcatcggctgcggctacccggaa
ggcgcgacgggccgcaacgtcggtcgccaggccgtcatccgcgcgggcctgcccgtcacc
gtgggcggcgccaccatcaaccgctattgcgcctcgggcctgcaggccattgcctcggca
gcaagccgcatcgtcatggatggcgcgcccgccatgattgccggcggcgtggaactggtg
tcgcagatccgcacccgcgacgacggcgtcagcggcatggacccatggatcgtggccaat
aagcccgaactctatctgcccatgatcgaaaccgcggacatcgtggcggcccgctacggc
atctcccgcgaagcccaggaccgctacgccgcgcaaagccaggcacgcaccgaagccgcg
caagccgccggccgctaccaggaagagatcattcccgtcaccaccaccatgtccgtcacc
gaccgcgcgacgggcgccgtcagcgagcgcgaggtcacggtggatcgcgacacctgcaac
cggcccggcaccacctacgacgccctggcctcgcttgcgcccgtgcgcggcgccggccag
ttcgtcacggcgggcaacgcctcgcaattgtccgatggcgccgctgcctgcgtgctgatg
gaggcctcggaagcccagcgcgccggcatccggccgctgggcgcgttccgcggactggcg
atcgcgggctgcgaacccgacgaaatgggcatcggcccggtctacgccgtgcccaagctg
ctggcgcgccacggcctcaaggtgcaggacatcgacctctgggaactgaacgaggccttt
gcctcgcaagccctgtactgccaggaaaagctaggcatcccgatggaccgcctgaacgtg
gacggcggcgccatcgcgctgggccatccatttggggtcacgggcgcccgcctggccggc
cacgtactcattgaaggccgccgccgcggcgcccgctatgccgtcgtcaccatgtgcgtg
ggcggcggcatgggcgcggccggcctgttcgaaatctactga

DBGET integrated database retrieval system