KEGG   Achromobacter insolitus: BUW96_12700Help
Entry
BUW96_12700       CDS       T04671                                 

Definition
(GenBank) gamma-glutamyltransferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
ais  Achromobacter insolitus
Pathway
ais00430  Taurine and hypotaurine metabolism
ais00460  Cyanoamino acid metabolism
ais00480  Glutathione metabolism
ais01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ais00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    BUW96_12700
   00460 Cyanoamino acid metabolism
    BUW96_12700
   00480 Glutathione metabolism
    BUW96_12700
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ais01002]
    BUW96_12700
Enzymes [BR:ais01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     BUW96_12700
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     BUW96_12700
Peptidases and inhibitors [BR:ais01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   BUW96_12700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept RE_LlaMI
Motif
Other DBs
NCBI-ProteinID: APX75646
UniProt: A0A3S5ELC6
Position
2785830..2787593
Genome map
AA seq 587 aa AA seqDB search
MANSSYAPDLTAGSAPTSMRPALTGLNHMVSAGHYLATQAGMDVLQAGGNAVDAGVAAGI
ALGVVQSDIVNFGGVAPILVYQARTRQVWSISGLGYWPEAARLETFLGKHAGTIPAGVLR
TVIPAAPDAWITALERFGTMSFGEVAASAIQLAREGFVMYPLMAEVLAENEKNYARWASS
AAIYLPGGKPPAAGEVFRQTDLARSIQYMADEERAHRDAGRLAGLAAARRAFYEGDIAAA
IVKYHREEGGLITHEDLRGFSVEVEPALSTEFHGTRVHSCGFWCQGPSLLQMLNILEPCE
LRALGHNSAPYVHLLTEAIKLAFADREVHYADPRHARVPQAALLSKEYARSRLALIRPDR
AGPEMPPAGRLPLARDIDLRAAGPDDMARTDPRLDTSYVAVVDKEGNAFSATPSDGSYNV
PVIPGTGICASGRGSQSWAEAGHPCAIGPGRRPRLTPNPSLAIKPGTYVMPFGTPGGDVQ
CQAMLQTFLNMEVFGMDVQQAVEAPRFATFSFPSSFEPHNAMPGRLMIEDLIARDAGDQL
AALGHTVKWWPGHSWRAGAVCMVRHDLDTGVRWGGADPRRPAYAAGW
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atggccaattcctcttacgccccggacctgaccgccggcagcgcgcccacttcgatgcgc
cccgcgctcaccggcctgaaccacatggtctcggcgggccattacctggccacgcaggcc
ggcatggacgtcctccaggcgggcggcaacgctgtcgacgcaggcgttgccgcgggcatc
gcgttgggcgtggtgcaaagcgacatcgtcaacttcggcggcgtggcgcccatcctggtc
tatcaggcccggacccgccaggtgtggagcatctccggcctggggtactggcccgaagcc
gcgcgcctggaaacattcctgggcaagcacgcgggcacgattccggccggcgtgctgcgc
accgtcataccggccgcccccgacgcctggatcaccgcgctggagcgcttcggcaccatg
agctttggcgaggttgcagccagcgccatccagctggcgcgagaaggcttcgtcatgtac
ccgctgatggcggaagtgctggccgaaaacgagaagaactacgcccgctgggcttccagc
gccgccatctacctgccgggcggcaagccgcccgcggcgggagaggtcttccgccagacg
gatctggcgcgcagcatccaatacatggccgacgaagagcgcgcgcaccgggatgccggc
cggctggcaggcctggcggcggctcgccgcgcattctacgaaggggatatcgccgccgcg
atcgtcaagtatcaccgggaagaaggcgggctgatcacccacgaggacctgcgcggcttc
tccgtcgaggtggaaccggcgctatccaccgagtttcacggcacgcgcgtgcacagttgc
ggcttctggtgccagggcccctcgctgctgcagatgctgaatattctcgagccgtgcgaa
ctgcgcgccctgggccataactccgccccctacgtgcatctgctgaccgaagccatcaaa
ctggcattcgctgaccgcgaagtccattacgccgatcctcgccacgcccgcgtgccgcaa
gcagccctgctgtccaaggaatatgcgcgttcgcgcctggccctgatcaggcccgatcgc
gcagggccggagatgccgccagcgggtcgcctccccttggcgcgcgatatcgacctgcgc
gcggcgggtcccgacgatatggcgcgcacggatccgcgcctggacacctcctacgtcgcg
gtcgtagacaaggagggcaacgccttttccgccacgcccagcgacggctcctacaacgtt
cccgtcattcccggcaccggcatctgcgcttccgggcgaggcagtcaatcctgggcggaa
gccggacatccctgcgccatcgggccaggccgccgtccgcggctgacgccaaatccgtcg
ctggcgatcaagccggggacgtacgtcatgccattcggcacgccgggcggcgacgtgcaa
tgccaggccatgctgcagaccttcctgaacatggaagtattcggcatggatgtgcagcaa
gcggtcgaagcgccgcgcttcgcgaccttcagctttccgtcgtcgttcgaaccgcacaac
gccatgcctggacggttgatgatcgaggacctgatcgcgcgcgacgccggcgaccagctg
gccgcgctggggcacacggtcaaatggtggcctgggcacagctggcgcgccggagcagtg
tgcatggtcaggcacgacctggacactggcgtccgctggggcggcgcggacccgcgccgg
ccggcctacgcggcgggctggtag

DBGET integrated database retrieval system