KEGG   Achromobacter insolitus: BUW96_12875Help
Entry
BUW96_12875       CDS       T04671                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
ais  Achromobacter insolitus
Pathway
ais00010  Glycolysis / Gluconeogenesis
ais00053  Ascorbate and aldarate metabolism
ais00071  Fatty acid degradation
ais00280  Valine, leucine and isoleucine degradation
ais00310  Lysine degradation
ais00330  Arginine and proline metabolism
ais00340  Histidine metabolism
ais00380  Tryptophan metabolism
ais00410  beta-Alanine metabolism
ais00561  Glycerolipid metabolism
ais00620  Pyruvate metabolism
ais00625  Chloroalkane and chloroalkene degradation
ais00903  Limonene and pinene degradation
ais01100  Metabolic pathways
ais01110  Biosynthesis of secondary metabolites
ais01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ais00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BUW96_12875
   00053 Ascorbate and aldarate metabolism
    BUW96_12875
   00620 Pyruvate metabolism
    BUW96_12875
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BUW96_12875
   00561 Glycerolipid metabolism
    BUW96_12875
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BUW96_12875
   00310 Lysine degradation
    BUW96_12875
   00330 Arginine and proline metabolism
    BUW96_12875
   00340 Histidine metabolism
    BUW96_12875
   00380 Tryptophan metabolism
    BUW96_12875
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BUW96_12875
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BUW96_12875
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BUW96_12875
Enzymes [BR:ais01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BUW96_12875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh ETF
Motif
Other DBs
NCBI-ProteinID: APX75675
UniProt: A0A162UWD6
Position
2814463..2815965
Genome map
AA seq 500 aa AA seqDB search
MDTPQDILRALGLNPESLTGGTLRARSPIDGAELAQVHEHTVAQAHSAITRARQASLAWR
DVPAPRRGELLRLFGETLRQHKRELGRLVSLEAGKIVAEGEGEVQEMIDICDFAVGLSRQ
LYGLTIASERPGHRMMETWHPLGVVGVISAFNFPVAVWSWNAALALVCGNAVVWKPSEKT
PLTALACQALFTQAAQRFGDAPAGLSEVLIGGRDIGEALVDSHAVALVSATGSTRMGRQV
GPRVAQRFGRVLLELGGNNAIIVGPTADLDMAARGIVFGAIGTAGQRCTTTRRLIVHESV
ANDLVQRLHKAYASATIGNPLDSATLVGPLIDRVSFDAMQAALTAAREQGGKVTGGERVL
AEQYPDAWYVRPAIAEMPGQTDVVCHETFAPILYVMRYTDFSQALALQNGVPQGLSSAIF
TNDLREAETFLSAAGSDCGIANVNIGTSGAEIGGAFGGEKETGGGRESGSDAWRNYMRRA
TNTINYSRQLPLAQGIKFGE
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggacactccccaagacatcctgcgcgcgctcgggctgaacccggaatcgctcaccggc
ggcacgctgcgcgcgcgcagcccgatcgatggcgccgaactggcccaggtccacgagcac
acggtcgcccaggcccattccgccatcacccgcgcgcgtcaggccagcttggcgtggcgc
gatgtgccggctccgcgccgcggcgagctgctgcgcctgtttggcgaaacgctgcgccag
cacaagcgcgaactgggccgcctggtcagcctggaagccggcaagatcgtcgccgaaggc
gaaggcgaagttcaggaaatgatcgacatctgcgatttcgccgtgggcctgtcgcgccag
ctgtacggcctgaccatcgcctccgagcgccccggccaccgcatgatggaaacctggcac
cccctgggcgtggtcggcgtgatcagcgcgttcaacttccccgtggccgtgtggtcctgg
aatgccgcgctggcgctggtttgcggcaatgccgtggtctggaagccgtcggaaaaaacc
cccttgaccgcgctggcctgccaggcgctcttcacccaggccgcgcaacgcttcggcgac
gcgcccgccgggctgtccgaagtgctgatcggcggccgcgacattggcgaagccctggtg
gattcgcacgccgtggccctggtgtcggccacgggttcgacccgcatgggccgccaggtg
gggccgcgcgtggcgcagcgcttcggccgcgtgctgctggagctgggcggcaacaacgcc
atcatcgtcggccccacggccgacctggacatggccgcgcgcggcatcgtgttcggcgcc
atcggcacggccggccagcgctgcacgaccacgcgccgcctcatcgtgcacgagagcgtg
gcaaacgacctggtgcaacgcctgcacaaggcctatgccagcgccaccatcggcaatccg
ctggacagcgccacgctggttggtccgctgatcgaccgcgtgtcttttgacgccatgcag
gccgcgcttacggccgcgcgcgaacagggcggcaaagtcaccggcggtgaacgcgtgctg
gccgagcagtatccggatgcctggtacgtgcgccctgccatcgccgagatgccgggccag
accgacgtggtctgccacgaaaccttcgcccccattctgtacgtgatgcgctacaccgat
ttcagccaggcactggccttgcagaacggcgtgccccagggcctgtcgtcggccatcttc
accaatgacctgcgcgaggccgagaccttcctgtccgcggcgggttctgactgcggcatt
gccaacgtcaacatcggcacatcgggcgccgagatcggcggagccttcggcggcgaaaag
gaaaccggcggcggccgcgaatcgggttccgatgcgtggcgcaactacatgcgccgcgcg
accaacacgatcaactattcgcgccaactgcccctggcccagggcatcaagttcggcgaa
taa

DBGET integrated database retrieval system