KEGG   Achromobacter insolitus: BUW96_16955Help
Entry
BUW96_16955       CDS       T04671                                 

Gene name
metG
Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ais  Achromobacter insolitus
Pathway
ais00450  Selenocompound metabolism
ais00970  Aminoacyl-tRNA biosynthesis
ais01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ais00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BUW96_16955 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BUW96_16955 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ais01007]
    BUW96_16955 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ais03016]
    BUW96_16955 (metG)
Enzymes [BR:ais01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BUW96_16955 (metG)
Amino acid related enzymes [BR:ais01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BUW96_16955 (metG)
Transfer RNA biogenesis [BR:ais03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BUW96_16955 (metG)
 Prokaryotic type
   Other AARSs
    BUW96_16955 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: APX76378
UniProt: A0A3S4SAW3
Position
3699751..3701817
Genome map
AA seq 688 aa AA seqDB search
MSRTLFVTTALPYANGSFHIGHIMEYIQADIWVRSMRMAGHTVHFVGADDAHGAPIMLKA
EKEGITPQALVARYAAERPQYLNGFHIRFDHWHSTDSAENVALSQDIYRALKAQDLIETR
SIEQFYDPVKGMFLADRYIKGECPKCHAKDQYGDSCEVCGAVYAPTELINPYSALTGATP
VLKSSDHFFFKLSDPRCVEFLQQWTTGSNAAGGKHLQPEMLAKTREWLGADDGEAKLGDW
DISRDAPYFGIEIPDAPGKYFYVWLDAPVGYLASLKSYCAVKGMDFDKLLDPAGPTEQVH
FIGKDIVYFHALFWPAMLQFAGRKTPDAVNVHGFITVSGEKMSKSRGTGISPLRYLELGM
NAEWMRYYIAAKLNARVEDMDFNPEDFIARVNSDLIGKYVNIASRAASFITKHFDGVLGY
SGDTSALAAEYAEQAESIRAAFEAREYNRAIREIMAYADRINQAFDTAQPWVLAKGIATA
DEAQKAALQDICSRSLAGFKALSVMLAPVLPALAERVALELFGAQAPFSWADASVLPQRV
APFKHLMQRVEPQMLEDLFEPPAAPVVVPGGEPIADTISIDDFARVDLRIAQIVNCEHVE
GSTKLLRLTLDAGEGRHRNVFSGIKSAYKPEDLIGKLTVLVANLAPRKMKFGVSEGMVLA
ASHADEAVDAGIYVLEPFPGAKPGMRVR
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgcaccctctttgtcaccactgcgctgccctacgccaacggatctttccacatc
ggccacatcatggagtacatccaggctgatatctgggttcgttcgatgcgaatggcgggc
cacacggtgcacttcgtgggtgcggacgacgcgcacggcgcgcccatcatgctgaaggcg
gaaaaggaaggcatcacgccgcaggccctggtggcccgctacgccgccgaacgccctcag
tacctgaacggcttccacatccgcttcgaccactggcattccaccgattcggccgagaac
gtcgcgctgtcgcaagacatctaccgcgcgctgaaggcccaggacctgatcgaaacccgc
tccatcgagcagttctacgatccggtcaagggcatgttcctggcagatcgctacatcaag
ggcgaatgccccaagtgccatgccaaggaccaatacggcgactcctgcgaggtctgtggc
gcggtctacgcgcccactgagctgatcaatccgtattcggccctgaccggcgccacgcca
gtgctgaagtcctcggaccacttcttcttcaagctgtccgatccgcgctgcgtggaattc
ctgcagcaatggaccaccggcagcaacgcagccggcggcaagcacctgcaacccgaaatg
ctggccaagacgcgcgaatggctgggcgcggacgatggcgaagccaagctgggcgactgg
gacatctcgcgcgacgccccctacttcggcatcgagatcccggacgcgccgggcaagtat
ttctacgtctggctggacgcccccgtgggctacctggcgtcgctgaagtcgtattgcgcg
gtcaagggcatggatttcgacaaactgctcgatcccgccggccccacggaacaggtccac
ttcatcggcaaggacatcgtgtacttccacgcgctgttctggcccgcgatgctgcagttc
gccggacgcaagacgcctgacgcggtgaacgtgcacggcttcatcaccgtcagcggcgaa
aagatgtccaagagccgcggcacgggcatttcgccgctgcgctacctggaactcggcatg
aatgccgaatggatgcgctactacatcgccgccaagctgaacgcgcgggtcgaagacatg
gacttcaatcccgaggacttcatcgcgcgcgtcaacagcgacctgatcggcaagtacgtc
aacatcgccagccgcgccgccagcttcatcaccaagcatttcgatggcgtcctgggctat
tcgggcgacacctcggcgctggccgcggagtacgccgaacaggctgagtccatccgcgcc
gcgttcgaggcgcgcgagtacaaccgcgccatccgcgaaatcatggcctacgccgaccgc
atcaaccaggcgttcgatacggcccagccgtgggtactggccaagggtatcgccacggcc
gacgaggcacaaaaggcagccctgcaggacatctgctcgcgctcgctggcgggcttcaag
gcgttgtccgtaatgctggcgccggtattgcccgcgctggccgaacgcgtggccctggaa
ctgttcggcgcccaggcgcccttcagttgggcagatgcctcggtgctgccgcaacgcgtg
gcgccgttcaagcacctgatgcagcgtgtcgaaccgcaaatgctggaagacctgttcgaa
ccgcccgcagcccccgtcgtggttcccggcggcgagcccattgccgacaccatctccatc
gatgatttcgcacgcgtcgacctgcgcatcgcccagatcgtcaactgcgaacacgtggaa
ggctcgacgaagctgctgcgcctgaccctggacgcgggcgaaggccgccaccgcaacgtg
ttctcgggcatcaagtcggcctacaagccggaagacctgatcggcaagctgacagtcctg
gtggccaacctggcgcctcgcaagatgaagttcggcgtctcggaaggtatggtgctggcg
gccagccacgcggatgaggcggtcgacgccggcatctacgtgctggaaccgttccccggc
gccaagcccggcatgcgcgtgcgctga

DBGET integrated database retrieval system