KEGG   Achromobacter insolitus: BUW96_21655Help
Entry
BUW96_21655       CDS       T04671                                 

Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
ais  Achromobacter insolitus
Pathway
ais00471  D-Glutamine and D-glutamate metabolism
ais00550  Peptidoglycan biosynthesis
ais01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ais00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BUW96_21655
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BUW96_21655
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ais01011]
    BUW96_21655
Enzymes [BR:ais01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     BUW96_21655
Peptidoglycan biosynthesis and degradation proteins [BR:ais01011]
 Precursor biosynthesis
  Amino acid ligase
   BUW96_21655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C FAD_oxidored NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: APX77192
UniProt: A0A162N6A0
Position
complement(4745730..4747262)
Genome map
AA seq 510 aa AA seqDB search
MNTMETSRADAPLVLILGLGETGVAAARWCARQGARLRVADTRAEPGGLAALRESLAQSE
VEYRLGCDESFDTALLDGVSQVVLSPGLAPAQPPAADLLREAEARGIEIVGEIELFARAL
ADLAETREYRPRLLTVTGTNGKTTVTALTRQLVEASGLSAVAAGNISPAALAALMDALDA
ESLPQVWVLELSSFQLETTRSLMADAAVVLNVTQDHLDWHGGMEAYAQAKARLLKMARVA
IVNRDDPYTVDMVATLNGLNVRSFGRDVPELVGDMGLELGQGVAWLVACEPNDFDEPAPP
VRRKKDAPEPVRAKGRMSRLMPVDALRIRGIHNALNALAALQLARCLDLGWGAMLRALRE
YTGEPHRAAFVRTIGGVDYINDSKGTNVGATVAALEGLGQQVVLIAGGLGKGQDFSPLIP
GVARHARAVMLIGQDGPEIGRVLAPTGVQCITVETLRDAVRGAAEIAQPGDAVLLSPACA
SMDMFRNYPHRGQVFVEEVEDLARDRGEIA
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgaatacgatggaaacctcccgcgcagacgcgccgctcgtcctgatcctcggattgggc
gagacgggtgtcgccgccgctcgctggtgcgcccgacagggcgcccgcttgcgcgtggcc
gacacgcgcgccgagccgggcggattggccgcgttgcgcgaatcgttggcccaaagcgag
gtggaataccgtctgggttgtgacgagtcgttcgacacggcgctgctggacggcgtaagc
caagtggtcctgagccctggcctggcgcctgctcaaccgcccgccgcggacctgctgcgc
gaggccgaggcccgtggcatcgagatcgtcggcgaaatcgaattgtttgcgcgcgcgctg
gccgacctggccgaaacgcgcgagtaccggccacgcctgttgaccgtgaccggcaccaac
ggcaagaccaccgttaccgccttgacgcgccagctggtcgaggccagcggcctgtcggcc
gtggcggccggcaacatcagtcctgcggcgctggccgcgctgatggacgcgctggatgcg
gaatcgctgccgcaggtctgggtgctggaactctccagcttccagctggaaaccacgcgt
tcgctgatggccgacgcggccgtcgtgctgaacgtcacccaggatcatctggattggcat
ggcggcatggaggcctacgcacaggccaaggcgcgtctgttgaaaatggcccgcgtggcc
atcgtcaaccgtgacgatccgtacaccgtcgacatggtcgcaacgctgaacgggctgaat
gtgcgcagcttcggccgcgacgtgccggaactggtcggcgacatgggcctcgagctgggc
cagggcgtggcttggctggtggcctgcgaacccaacgatttcgatgagcccgcgccgccg
gtgcgccgcaagaaggatgcgcccgagcccgtccgcgccaagggtcgcatgagccgcctg
atgccggtggacgcgttgcgcatccgcggcatccacaatgccttgaatgccctggccgcg
ctgcaactggcgcgctgcctggacctgggctggggcgccatgctgagggcgctgcgcgag
tacaccggggaaccccaccgcgccgcgttcgtgcgcacgatcggcggcgtcgactatatc
aatgacagcaagggcaccaacgtgggcgctacggtcgccgcgctggaaggcctgggccag
caggtggtgctgatcgccggcggcctgggcaagggccaggatttctcgccgctgattccg
ggcgtggcgcgccatgcgcgagccgtgatgctgatcggccaggacggcccggagatcggc
cgcgtgctggcgccgaccggcgtacagtgcatcacggttgaaacgctgcgcgacgcggtg
cgcggcgccgccgaaatcgcccagccgggcgatgccgtgctgttgtcgcccgcctgcgcc
agcatggacatgttccgcaactatccgcatcgcggacaggtattcgtggaagaggtcgaa
gacctggcccgcgaccgtggagagatcgcatga

DBGET integrated database retrieval system