KEGG   Achromobacter insolitus: BUW96_25920Help
Entry
BUW96_25920       CDS       T04671                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
ais  Achromobacter insolitus
Pathway
ais00260  Glycine, serine and threonine metabolism
ais01100  Metabolic pathways
ais01110  Biosynthesis of secondary metabolites
ais01120  Microbial metabolism in diverse environments
ais01130  Biosynthesis of antibiotics
ais01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ais00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BUW96_25920
Enzymes [BR:ais01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     BUW96_25920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: APX77925
UniProt: A0A448JLF2
Position
5630261..5631316
Genome map
AA seq 351 aa AA seqDB search
MNQTSSAAAHAPVDLRSDTVTHPTAAMYERMRTAPIGDDGLDGDPTVRELEAYVAAQLGK
QAGLFVPSCTMANLLAVLAQTQRNEQVVLESAAHMYTSERGAATFTGVFYLGVPGTDGAM
DLNRLEETLLPGGHRLKTALVTMETSHNNAAGAVLPLDHMQAVRSLAQAAGAPVHLDGAR
LYNAAVALGVAAEEIARHADTVSLCLSKGLSAPVGAVLAGSQPVMARARVLRRMLGGTQR
QSGIMAAAGLEGVQTMGGRLVEDHARARRLSVGVNRLGPAISATEPQTNIVQVETAGTGL
SNTEWVAALQTAGLLVRPWGRTRLRCVTHRHIGDADIDAAVLAFETVLNGR
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagacctcttccgccgccgcgcacgcacccgtcgacctgcgcagcgacacggtc
acccatcccaccgcggccatgtacgaacggatgcgcaccgcccccattggcgatgacggc
ctggacggcgaccccaccgtgcgcgagctcgaggcctatgtggccgcgcagctgggcaag
caagccgggctgttcgtgcccagctgcaccatggccaatctgctggcggtcctggcgcag
acgcagcgcaatgaacaggtcgtgctggagtcggccgcgcacatgtacacgtccgaacgt
ggcgccgccacgttcaccggcgtgttttacctgggcgtgccggggacggacggcgccatg
gacctgaaccggctggaagagaccttgctgcccggcggccacaggctgaagaccgcgttg
gtgaccatggaaacctcgcataacaatgccgccggcgcggtgctgccgctggatcacatg
caggcggtccgcagcctggcgcaggcggccggcgcccccgtgcatctggacggcgcgcgg
ctgtacaacgcggccgtggcgctgggtgtggcggcggaggaaattgcccgccatgccgac
acggtgtcgctgtgtctgtccaagggcttgagcgcgccggtgggcgcggttctggcgggc
agccaacccgtgatggctcgtgcccgcgtactgcgccgcatgctgggcggcacgcagcga
cagtcgggcatcatggccgcggccggactggaaggcgtgcagaccatgggcggccggctg
gtcgaagaccatgcgcgcgcacgccgcctgagcgtgggcgtcaaccggctgggaccggcc
atctcggcgaccgaaccgcagacgaacatcgtgcaggtcgaaaccgcgggcaccggcttg
agcaatacggagtgggtagcggcgctgcagacggcgggcctgctggtgcgcccatggggc
cgcacgcggctgcgctgcgtgactcatcgccacatcggcgacgcggacatcgacgcggcg
gtgctggccttcgaaacggtgctgaacggccgctga

DBGET integrated database retrieval system