KEGG   Achromobacter insolitus: BUW96_26395Help
Entry
BUW96_26395       CDS       T04671                                 

Definition
(GenBank) arginine--tRNA ligase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
ais  Achromobacter insolitus
Pathway
ais00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:ais00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BUW96_26395
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ais01007]
    BUW96_26395
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ais03016]
    BUW96_26395
   03029 Mitochondrial biogenesis [BR:ais03029]
    BUW96_26395
Enzymes [BR:ais01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     BUW96_26395
Amino acid related enzymes [BR:ais01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   BUW96_26395
Transfer RNA biogenesis [BR:ais03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BUW96_26395
 Prokaryotic Type
   Other AARSs
    BUW96_26395
Mitochondrial biogenesis [BR:ais03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BUW96_26395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DALR_1 Arg_tRNA_synt_N tRNA-synt_1d tRNA-synt_1f tRNA-synt_1 tRNA-synt_1g
Motif
Other DBs
NCBI-ProteinID: APX78009
UniProt: A0A162S0J3
Position
complement(5731254..5732951)
Genome map
AA seq 565 aa AA seqDB search
MLLEQQKQLISLIQAAVAQSLPDAQADTARANVLLERPKVAAHGDVATNVAMQLAKPARR
NPRELAQAIVDALMAQPGAVDLIEAAEIAGPGFINLRITPAARQAVIAAVAEQGAAFGRS
PRNGEKILVEFVSANPTGPLHVGHARQAALGDAICRLYDAIGWDVTREFYYNDAGNQIQN
LAISVQARARGLTTDSPDWPADGYKGDYIADIARDFQARATIQSDGVAVTATGDVDNLED
IRVFAVAYLRREQDLDLQAFGLAFDNYYLESSLYTSGRVEATVKALIAGGHTYEEGGALW
LRTTELGTGDDKDRVMRKSEGGYTYFVPDVAYHKAKWERGFHRAVNIQGSDHHGTVARVR
AGLQALEEGIPKDYPAYVLHKMVKVMRGGEEVKISKRAGSYVTMRDLIDWVGRDAVRYFL
IQRRADTEFVFDVDLALSKSDENPVYYIQYAHARICSVVNNAAMPAADVAQADAALLTAP
TEFALMQRLAEFPSVVALAAQDLSPHHIAFWLRDCASDFHAWYNAERVLVDDTALKLARL
RLASTTRQVLANGLELLGVSAPERM
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgctcctcgagcaacaaaaacagcttatctccctgatccaggccgccgtcgcgcaaagc
ctgcccgatgcccaggccgatacggcccgggccaacgtgcttctggagcgccccaaggtc
gccgcccacggcgacgtcgccaccaacgtggccatgcaactggccaagcccgcccgccgc
aacccgcgtgaactggcccaggccatcgtcgacgccttgatggcgcagcctggcgccgtc
gacctcatcgaggccgccgagatcgccggccctggcttcatcaatctgcgcatcaccccc
gccgcgcgccaggccgtcatcgccgccgtggccgagcagggcgccgctttcggccgctcg
ccgcgcaacggcgagaagatcctggtcgagttcgtgtcggccaatcccaccggcccgctg
cacgtgggccacgcccgccaggctgcgcttggggacgccatctgccgcctgtacgacgcc
atcggctgggacgtcacgcgcgagttctattacaacgacgccggcaaccagatccagaac
ctggccatcagcgtgcaagcccgcgcccgcggcctgacgaccgattcccccgactggccc
gccgacggttacaagggcgattacatcgccgatatcgcgcgcgatttccaagcccgcgcg
accatccagtccgacggcgtggccgtcaccgccacgggcgatgtcgacaacctcgaagac
atccgcgtcttcgccgtggcctatctgcgccgcgagcaggatctggacctgcaggccttc
ggcctggcgttcgacaattactacctggaaagctcgctctacacctccggccgggtcgaa
gcgaccgtcaaggcgctgatcgccggcggccatacctacgaggaaggcggcgccctgtgg
ctgcgcaccaccgaactgggcacgggcgacgacaaagatcgcgtcatgaggaagagcgaa
ggcggctacacctacttcgtgcctgacgtggcctatcacaaggccaaatgggaacggggc
tttcaccgcgccgtgaacatccagggcagcgaccaccacggcaccgtggcgcgcgtgcgc
gccggcctgcaggcgctggaagagggtattcccaaggactaccccgcctacgtgctgcac
aaaatggtcaaagtcatgcggggcggcgaagaggtcaagatctccaagcgcgccggcagc
tatgtgaccatgcgcgacctgatcgactgggtgggccgcgacgcggtgcgctacttcctg
atccagcgccgcgccgacacggaattcgtgttcgacgtggacctggcactgtccaagagc
gacgagaaccccgtctattacatccagtatgcgcacgcccgcatctgctcggtggtgaac
aacgccgccatgccggccgccgacgtggcccaggccgatgccgcgctgctgaccgcgccg
accgaattcgcgctgatgcagcgcctggccgaattccccagcgtcgtggcgctggcggcg
caggatctgtcgccgcaccatatcgcgttctggctgcgcgactgcgcctcggatttccat
gcctggtacaacgctgaacgcgtgctggtcgacgacacggccctgaagctggcgcgtctg
cgcctggcctcgaccacgcgccaggtgctggccaacggcctggaactgttgggcgtgtcc
gcgcccgagcggatgtaa

DBGET integrated database retrieval system