KEGG   Achromobacter insolitus: BUW96_29510Help
Entry
BUW96_29510       CDS       T04671                                 

Definition
(GenBank) Fe/S-dependent 2-methylisocitrate dehydratase AcnD
  KO
K20455  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming) [EC:4.2.1.117]
Organism
ais  Achromobacter insolitus
Pathway
ais00640  Propanoate metabolism
ais01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ais00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BUW96_29510
Enzymes [BR:ais01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.117  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming)
     BUW96_29510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: APX78551
UniProt: A0A448JNE5
Position
complement(6399958..6402567)
Genome map
AA seq 869 aa AA seqDB search
MNQNYRKPLPGTRLDYFDTRAAVEAISPGAYDRLPYTSRVLAENLVRRCDPAMLTDALKQ
LIERRRDLDFPWFPARVVCHDILGQTALVDLAGLRDAIADKGGDPAKVNPVVPVQLIVDH
SLAVEYGGDDPDAFAKNRAVEDRRNEDRFHFIDWTKQAFRNIEVVPPGNGIMHQINLERM
SPVIYTQDGVAFPDTLVGTDSHTPHVDALGVIAIGVGGLEAENVMLGRASWMRLPDIIGV
ELTGRAQPGITATDIVLTLTEFLRKEKVVGAYLEFYGEGAASLTLGDRATISNMAPEYGA
TAAMFSIDQQTIDYLRLTGREDEQIALVETYAKTAGLWSDSLKNAEYERVLRFDLSSVVR
TLAGPSNPHRRLPVSDLAERGISGVVENNPGQMPDGAVIIAAITSCTNTSNPRNVIAAGL
LARNANRAGLTRKPWVKSSLAPGSKAVSLYLDEAGLTPELEKLGFGVVAFACTTCNGMSG
ALDPVIQQEIIDRDLYATAVLSGNRNFDGRIHPYAKQAFLASPPLVVAYAIAGTIRFDIE
RDVLGHDASGREIRLKDIWPSDEEIDAVVKSAVKPEQFRKVYAPMFGIQDDRKAAVSPLY
AWRAQSTYIRRPPYWEGALAGERTLRGMLPLAVLGDNITTDHLSPSNAILMDSAAGEYLH
KMGLPEEDFNSYATHRGDHLTAQRATFANPKLFNEMVKNEDGTVKQGSLARVEPEGKVMR
MWEAIETYMDRKQPLIIVAGADYGQGSSRDWAAKGVRLAGVEAIVAEGFERIHRTNLIGM
GVLPLEFKPGVNRKTLGLDGTESYDVIGERTPRADLTLVVHRRNGETVQVPVTCRLDTAE
EVSIYEAGGVLQRFAQDFLEASGADKKAG
NT seq 2610 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaaaactaccgcaagcccctgcctggcactcgcctggactacttcgacacccgc
gccgccgtcgaggcgatttcgcccggggcctatgaccgcctgccctacacctcgcgggta
ttggcggaaaacctcgtgcgccgctgcgatccggccatgctgacggacgcgttgaagcag
ttgatcgagcgccgccgcgacctggacttcccgtggttccccgcacgggtcgtctgtcac
gacatcctgggccagaccgcgctggtggacctggccggcctgcgcgacgccatcgccgac
aagggcggcgatcccgccaaggtcaatccggtagtgccggtgcagttgatcgtcgaccac
tctttggccgtggaatatggtggcgacgaccccgatgccttcgccaagaaccgcgccgtg
gaagaccgccgcaacgaagaccgcttccatttcattgactggaccaagcaggccttccgc
aacatcgaagtcgtgcctccgggcaacgggatcatgcaccagatcaacctggagcgtatg
tcccccgtcatctacacgcaagacggcgtggccttccccgacacgctggtcggcaccgac
agccacaccccgcacgtggatgcgctgggcgtgatcgctatcggcgtgggcggcctggaa
gccgagaacgtcatgctgggccgcgcctcctggatgcgcctgcccgacatcattggcgtg
gaacttactggccgcgcgcaaccgggcatcaccgccaccgacatcgtgctgaccctgacc
gaattcctgcgcaaggagaaggtcgtgggcgcctacctggagttctacggtgaaggcgcc
gccagcctgacgctgggcgaccgcgccaccatttcgaacatggcgcccgagtatggcgcg
acggctgccatgttctccatcgatcagcagaccatcgactatctgcgcctgaccggccgc
gaggacgaacagatcgccctggtggaaacctacgccaagaccgcgggcctctggtccgac
agcctcaagaacgccgaatacgaacgcgtgctgcgctttgatctctccagcgtggtgcgc
accctggccggcccgtccaatccgcaccgccgtctgccggtcagcgacctggcagagcgc
ggcatctctggcgtggtggaaaacaatcccggccagatgcccgatggcgccgtgatcatc
gccgccatcaccagctgcaccaacaccagcaatccacgcaacgtcatcgccgccggcctg
ctggcgcgcaacgccaaccgtgccgggctgacccgcaagccctgggtgaagagctcgctg
gcgccgggatccaaggcggtgtcgctgtacctggacgaagccggcctgacgccggaactg
gaaaaactgggcttcggcgtggtcgcctttgcctgtaccacgtgtaacggcatgtccggc
gcgctggaccccgtcatccagcaggaaatcatcgaccgcgacctttacgcgaccgcagtc
ctgtccggcaaccgcaacttcgacggccgcatccacccctatgccaagcaggccttcctg
gcctcgccgccgctggtggtggcctatgccatcgccggcaccatccgcttcgacatcgag
cgcgacgtgctgggccatgacgccagcggccgcgagatccgcctgaaggacatctggccc
agcgacgaagagatcgacgccgtggtcaagtcggcggtcaaacccgagcaattccgcaag
gtctacgcccccatgttcggcatccaggacgaccgcaaggccgcggtcagcccgctgtat
gcatggcgcgcgcagagcacctacatccgccgcccgccgtactgggaaggcgcgctggcc
ggtgaacgcacgctgcgcggcatgctgccgctggccgtgctgggcgacaacatcaccacc
gaccacctgtcgccctccaacgccatcctgatggacagcgccgcgggcgaatacctgcac
aagatgggcctgcccgaagaagacttcaactcctacgccacccaccgcggcgaccacctc
accgcgcaacgcgccactttcgccaatcccaagctcttcaacgaaatggtgaagaacgaa
gacggcacggtaaagcagggctcgctggcgcgcgtggaacccgaaggcaaggtcatgcgc
atgtgggaagccatcgagacttacatggaccgcaaacagccgctgatcattgtggccggc
gccgactacggccaaggctcgtcgcgcgactgggccgccaagggcgtgcgcctggccggc
gtggaagccatcgtcgccgaaggcttcgaacgcattcaccgcaccaacctgatcggcatg
ggcgtgctgccgctggaattcaagcccggcgtcaaccgcaaaaccctgggcctggacggc
acggaaagctatgacgtgatcggcgaacgcaccccgcgcgccgacctcacgctggtggtc
caccgccgcaatggcgaaaccgtgcaggttcccgtgacctgccgcctggacaccgccgag
gaagtctcgatctacgaagccggcggcgtgctgcagcgcttcgcccaggatttcctggag
gcctccggcgccgacaagaaggccggctga

DBGET integrated database retrieval system