KEGG   Amycolatopsis japonica: AJAP_01025Help
Entry
AJAP_01025        CDS       T03225                                 

Definition
(GenBank) Hypothetical protein
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
aja  Amycolatopsis japonica
Pathway
aja00310  Lysine degradation
aja01100  Metabolic pathways
aja01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    AJAP_01025
Enzymes [BR:aja01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     AJAP_01025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO NAD_binding_8 FAD_binding_2 Pyr_redox_2 FAD_binding_3 Amino_oxidase Pyr_redox HI0933_like Pyr_redox_3 NAD_binding_7 AlaDh_PNT_C GIDA UDPG_MGDP_dh_N Thi4 ApbA TrkA_N 3HCDH_N Lycopene_cycl Trp_halogenase NAD_binding_9 FAD_oxidored IlvN
Motif
Other DBs
NCBI-ProteinID: AIG73142
UniProt: A0A075UGR3
Position
complement(204545..205741)
Genome map
AA seq 398 aa AA seqDB search
MRTVVVIGGGIVGLATAWELTKRGLDVTVLEKEEHWAAHQTGHNSNVVHAGLYYKPGSFK
ARMSTAGNRSIVDFARQYGVPVEVCGKLVVATSEAELPALKVLAERAEANGVPAKLITPS
EAREYEPEVSCVAALRVESTGIIDFAGVCAALVRLLDESDADLRLGTPALGIRPGRTGGV
EVATGDDVIHADALVNCAGLHADRVARLAGLTPSARIVPFRGEYYELKPERRHLVRGLIY
PVPDASLPFLGVHLTRMLDGSVHAGPNAVLALRREGYTWRDVSAKDLAEVARFPGVWRLA
RKYAYPTGLDEVRRSFSRRRFAESLARLVPAVTEDDIVRHGSGVRAQALRPDGALVDDFL
IETARNQVHVLNAPSPAATSALEIAKHIADEVTGQAVS
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcacagtcgtagtcatcgggggcgggatcgtcggtctcgccacagcctgggaactg
accaaacggggtctggacgtcacggtgctcgagaaggaggagcactgggcggcccaccag
accgggcacaactccaacgtcgtgcacgccgggctctactacaagccgggttccttcaag
gccaggatgtccaccgcgggcaatcggtccattgtggacttcgcccggcagtacggggtg
ccggtcgaggtgtgcggcaaactcgtcgtcgccacctccgaagcggagcttccggcgctc
aaggtgctcgccgaacgcgcggaggccaacggggtcccggccaagctgatcaccccgagc
gaggcccgcgagtacgagcccgaggtctcgtgcgtcgccgcgttgcgcgtggagtccacc
ggcatcatcgacttcgcgggcgtctgcgccgcgctggtgcggctgctcgacgagtccgac
gccgacctgcggctcggcacgcccgcgctggggatccggcccggccgcaccggcggcgtc
gaggtggcgaccggcgacgacgtgatccacgcggacgccctcgtcaactgcgcgggcctg
cacgcggaccgggtcgcccggctcgccgggctcaccccgagcgcgcggatcgtgccgttc
cgcggcgagtactacgaactgaagcccgaacgccgccatctggtgcggggcctgatctac
ccggtccccgacgcgtcgctgccgttcctcggcgtgcacctgacccgcatgctcgacggc
agcgtgcacgccggccccaacgccgtgctcgcgctgcggcgtgagggctacacctggcgc
gacgtgtcggcgaaagacctcgccgaggtcgcccgtttccccggtgtctggcggctcgcg
cgcaagtacgcgtacccgaccgggctcgacgaggtccgccggtcgttctcccgccgccgc
ttcgccgaaagcctcgcgcggctcgtgcccgccgtcaccgaggacgacatcgtgcggcac
ggctccggggtccgggcacaggcgctgcgcccggacggcgccctcgtcgacgacttcctg
atcgagaccgcgcggaaccaggtgcacgtcctcaacgcaccctcaccggcggcgaccagc
gcgctggagatcgcgaagcacatcgccgacgaggtgaccggccaggccgtgtcctag

DBGET integrated database retrieval system