KEGG   Amycolatopsis japonica: AJAP_08875Help
Entry
AJAP_08875        CDS       T03225                                 

Gene name
pyc
Definition
(GenBank) Pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
aja  Amycolatopsis japonica
Pathway
aja00020  Citrate cycle (TCA cycle)
aja00620  Pyruvate metabolism
aja01100  Metabolic pathways
aja01120  Microbial metabolism in diverse environments
aja01200  Carbon metabolism
aja01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AJAP_08875 (pyc)
   00620 Pyruvate metabolism
    AJAP_08875 (pyc)
Enzymes [BR:aja01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     AJAP_08875 (pyc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Dala_Dala_lig_C Biotin_lipoyl ATP-grasp ATP-grasp_3 Biotin_lipoyl_2 RnfC_N ATP-grasp_4 GCV_H HlyD_D23
Motif
Other DBs
NCBI-ProteinID: AIG74674
UniProt: A0A075UQB8
Position
1786180..1789557
Genome map
AA seq 1125 aa AA seqDB search
MFRKVLVANRGEIAIRAFRAGFELGAGTVAVFPHEDRNSLHRLKADEAYEIGEPGHPVRA
YLSVEEIVAAAKKAGADAVYPGYGFLSENPDLARACEDEGITFVGPSADILELTGNKARA
VKAARDAGVPVLGSSEPSSDVDALIAAAEEIGFPVFVKAVAGGGGRGMRRVQEPAQLRES
IEAAAREAESAFGDPTVFIEKAVVEPRHIEVQILADGEGNVIHLYERDCSVQRRHQKVVE
LAPAPNLPSELRDRICADAVKFARQIGYRNAGTVEFLLDRDGNHVFIEMNPRIQVEHTVT
EEVTDVDLVQSQLRIASGETLEDLGLSQDKVYLRGAALQCRITTEDPANGFRPDTGMISA
YRSPGGSGIRLDGGTAFAGTEISAHFDSLLVKLSCRGRDFKTAVGRARRAVAEFRIRGVA
TNIPFLQAVLDDPDFREGRVTTSFIEERPHLLTARHSADRGTRLLTYLADKTVNKPHGER
PRTLDPQVKLPKLPKGLEPAPGSKQKLTELGPEGFARWLRESPTIGVTDTTFRDAHQSLL
ATRVRTKDLLAVAPVVARTTPQLLSLECWGGATYDVALRFLAEDPWERLAKLREAVPNIC
LQMLLRGRNTVGYTPYPTEVTNAFVEEATATGIDIFRIFDALNDVEQMRPAIEAVRETGS
AVAEVALCYTSDLSDPAEKLYTLDYYLKLAEQIVGAGAHVLAIKDMAGLLRAPAAVRLVS
ALRKEFDLPVHIHTHDTAGGQLATYLAAIQAGADAVDGAVASMAGTTSQPSLSALVAATD
HSDRPTGLDLQAIGDLEPYWESVRKIYAPFEAGLSSPTGRVYHHEIPGGQLSNLRTQAIS
LGLGERFEDIEAMYAAADKILGHLVKVTPSSKVVGDLALHLVGAGVSPSDFEAEPNKFDI
PDSVIGFLRGELGDPPGGWPEPFRTKALEGRAQPKPVQELSEEDHKGLAEDRRATLNRLL
FPGPTKDFEAHREQYGDTSVLPSKDFFYGLRPGEEYSVDLEQGVRLLIELEAIGEADERG
LRTVMSTLNGQLRPIQVRDTAIASDIPATEKAAKGDPKQIAAPFAGVVTLQVSEGDEVEA
GATVATIEAMKMEASITASTGGKVSRRAINAVQQVEGGDLLLVLE
NT seq 3378 nt NT seq  +upstreamnt  +downstreamnt
atgttccgcaaggtactggtcgccaaccggggtgagatcgccatccgcgcgttccgcgcc
ggattcgagctcggcgcgggcacggtggctgtgttcccgcacgaagaccgcaattcgctc
caccggctgaaggccgacgaggcctacgagatcggcgaacccggtcacccggtgcgggcc
tatctgtcggtcgaggaaatcgtggcggccgccaagaaggcgggcgcagacgccgtctac
cccggctacggcttcctctccgagaacccggacctcgcgcgcgcgtgcgaggacgaagga
atcaccttcgtcggaccgagcgcggacatcctcgagctgaccggcaacaaggcccgtgcg
gtcaaggccgcccgcgacgccggtgtgccggtgctgggttcttccgaaccgtcctccgac
gtcgacgcgctgatcgccgcggccgaggagatcggcttcccggtgttcgtcaaggccgtc
gccggtggtggcggccgcggtatgcgccgcgtccaggaacccgcgcagctgcgcgagtcc
atcgaggccgccgcgcgcgaggccgagtcggccttcggcgacccgacggtgttcatcgag
aaggccgtcgtcgagccgcgccacatcgaggtccagatcctcgccgacggcgagggcaac
gtgatccacctctacgagcgcgactgctcggtccagcggcggcaccagaaggtcgtcgag
ctggccccggcgccgaacctgccgtccgaactgcgggaccggatctgcgccgacgcggtg
aagttcgcccgccagatcggctaccgcaacgccggcaccgtcgagttcctgctcgaccgg
gacggcaatcacgtcttcatcgagatgaacccgcgcatccaggtcgagcacacggtgacc
gaggaggtcaccgacgtcgacctcgtccagtcgcagctgcgcatcgcctccggcgagaca
ctcgaagacctcggcctgtcacaggacaaggtgtacctgcgcggcgccgccctgcagtgc
cgcatcaccaccgaggatcccgccaacggcttccgccccgacaccgggatgatcagcgct
taccgctcgcccggtggttccggcatccgcctcgacggcgggacggcgttcgccggcacc
gagatcagcgcgcacttcgactcgctgctggtgaagctcagctgccgcggccgcgacttc
aagaccgccgtcggccgcgcccgccgcgcggtcgccgagttccggatccgcggtgtggcc
acgaacatcccgttcctgcaggccgtcctcgacgacccggacttccgcgaaggccgcgtc
acgacgtcgttcatcgaggagcgcccgcatctgctcaccgcgcgccattcggccgaccgc
ggcaccaggctgctgacctacctcgccgacaagacggtcaacaaaccgcacggcgagcgt
ccgcgcaccctcgacccgcaggtgaaactgccgaagctgcccaagggcctcgaaccggcg
cccggctcgaagcagaagctcaccgaactgggcccggagggcttcgcccgctggctgcgg
gagtcgccgaccatcggcgtcaccgacaccaccttccgcgacgcgcaccagtcgctgctc
gccacccgcgtgcggacgaaggatctgctcgccgtcgcgccggtcgtcgcgcggaccacg
ccgcagctgctctcgctggagtgctggggcggcgcgacctacgacgtcgcgctgcggttc
ctcgccgaagacccgtgggagcggctggcgaagctgcgggaagcggtgccgaacatctgc
ctgcagatgctgctgcgcggccgcaacaccgtcggctacacgccgtaccccaccgaggtg
accaacgccttcgtcgaggaggcgacggcgaccggcatcgacatcttccggatcttcgac
gcgctcaacgacgtcgagcagatgcgcccggcgatcgaagccgtccgcgagaccggatcc
gccgtggccgaggtggcgctctgctacacctcggatctgtcggacccggccgagaagctg
tacacgctggactactacctcaagctggcggagcagatcgtcggcgcgggggcgcacgtc
ctggccatcaaggacatggcgggcctgctgcgggcgccggcggcggtgcggctggtttcc
gcgctgcgcaaggaattcgaccttccggtgcatatccacacgcatgacaccgcgggtggg
cagctggcgacgtacctcgccgcgatccaggccggggcggacgccgtcgacggtgccgtc
gcgtccatggcgggcaccacgtcgcagccgtcgctgtccgcgctcgtcgcggccaccgac
cactcggaccggccgaccgggctggatctgcaggccatcggcgacctggagccgtactgg
gagagcgtgcgcaagatctacgcgccgttcgaggcggggctctcgtcgccgaccgggcgc
gtgtaccaccacgagatcccgggcggtcagctgtcgaacctgcgcacgcaggcgatttcg
ctcggcctcggcgagcggttcgaggacatcgaggcgatgtacgcggccgcggacaagatc
ctcgggcacctggtcaaggtcacgccttcgtccaaagtggtcggtgacctcgcgctgcac
ctcgtcggcgcgggtgtctcgccctcggatttcgaggcggagccgaacaagttcgacatc
cccgactcggtgatcggcttcctgcgcggcgaactgggcgacccgcccggcggctggccg
gagccgttccgcaccaaggccctcgaaggccgcgcgcagccgaagccggtgcaggaactg
tccgaagaggaccacaagggactcgccgaggaccggcgcgcgacgctgaaccggctgctg
ttccccgggcccacgaaggacttcgaggcgcaccgcgagcagtacggtgacacctccgtc
ctgccgtccaaggacttcttctacggcctgcggccgggcgaggagtactcggtcgacctg
gaacagggtgtccggctgctgatcgagctggaggccatcggcgaggccgacgagcgcggc
ctgcgcacggtgatgtccacgctcaacggccagctgcgcccgatccaggtccgcgacacc
gcgatcgcgtcggacatcccggcgacggagaaggccgccaagggcgacccgaagcagatc
gccgcgccgttcgcgggcgtggtcacgctgcaggtgtccgagggtgacgaggtcgaggcc
ggtgccacggtcgcgaccatcgaggcgatgaagatggaggcgtcgatcacggcgtcgacc
ggcggcaaggtgtcgcggcgcgcgatcaacgccgtccagcaggtggaaggaggggacctg
ctgctcgtcctggagtga

DBGET integrated database retrieval system