KEGG   Amycolatopsis japonica: AJAP_10060Help
Entry
AJAP_10060        CDS       T03225                                 

Definition
(GenBank) Conserved putative secreted protein
  KO
K01113  alkaline phosphatase D [EC:3.1.3.1]
Organism
aja  Amycolatopsis japonica
Pathway
aja00790  Folate biosynthesis
aja01100  Metabolic pathways
aja02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aja00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AJAP_10060
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AJAP_10060
Enzymes [BR:aja01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     AJAP_10060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoD PhoD_N Pur_ac_phosph_N Metallophos TAT_signal
Motif
Other DBs
NCBI-ProteinID: AIG74909
UniProt: A0A075UQV7
Position
complement(2031595..2033130)
Genome map
AA seq 511 aa AA seqDB search
MSVNRRDLLRGAATAGALGLAWPLSSRMTVAQAEEAAVALGATWDEAPFTLGVASGDPVP
YGVALWTRLAPKPMEFEQPLDDTVEVGWEVATDRGFRRRVARGTTAATAGAGHSVHVPVS
GLEPGSQYYYRFHVLGKVSRIGRTRTAPVGPVRRVRFASANCQAFHDGFYAAHAGIAREE
LDFVVHLGDYVYEHGQVGGNPLRDHEGPEVLTLPAYRRRHALYKSDPSLRDAHAAHPWFI
TWDDHEVVNDYSGTTPSLRARRSAAYQAWFEHMPVRPDHPSTPRIHRQRRWGDLLDLSIL
DLRQYRSAQNLPDGTILGADQKAWLKDQVTGAGEAWHCWVNSIMLSQLAKPGGGYMFTDQ
WDGFLAERKEVLTHVAQSGLEDLVVITGDWHSAFVDDIRPDFADPATPVIGTEFTAHSVT
SGAYSPEWNATNGPKMGAANPHLKYFEGDRYGYDVYEVTPRRWSTHMRVIGDRRDPRSPV
STLTTFHVDRGRAGSYEDRSTSTSPAQYRRR
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtcaaccgccgggacctgttgcgaggcgccgccaccgccggtgcgctggggctg
gcctggccgttgagttcgcggatgacggtcgcgcaggccgaggaggccgccgtcgcactg
ggcgcgacctgggacgaggcgccgttcacgctcggcgtcgcgtccggcgacccggtcccg
tacggcgtcgcgctctggaccaggctcgcgccgaaaccgatggagttcgagcagccgctc
gacgacaccgtcgaggtcggctgggaggtggccaccgaccgcgggttccgccgccgcgtg
gcgcgtgggacgacggccgcaaccgccggggccggacacagcgtgcacgtgccggtgtcc
gggctggagccgggctcgcagtactactaccgcttccacgtgctcggcaaggtcagccgg
atcggccgcacccgcaccgcgccggtcgggccggtccggcgggtgcggttcgcctcggcg
aactgccaggcgttccacgacgggttctacgcggcgcacgccgggatcgcgcgggaggag
ctggacttcgtcgtccacctcggcgactacgtctacgagcacggtcaggtcggcggcaac
ccgctgcgcgaccacgaaggtcccgaggtgctgaccctgcctgcgtaccggcggcgccac
gcgctctacaagtccgacccctcgttgcgggacgcccacgcggcccacccctggttcatc
acctgggacgatcacgaggtcgtcaacgactacagcggcaccaccccgtcgttgcgggcg
cgacgctcggcggcgtatcaggcctggttcgagcatatgccggtgcgcccggaccacccc
tcgacgccgaggatccaccgtcagcgccgctggggcgacctcctcgacctgtccattttg
gacctgcggcagtaccgctcggcgcagaacctgcccgacggcacgatcctcggcgcggac
cagaaggcgtggctcaaggaccaggtgaccggggccggcgaggcctggcactgctgggtg
aactcgatcatgctgagccagctggcgaagcccggcggcggctacatgttcacggaccag
tgggacggcttcctcgccgaacgcaaggaggtgctgacccacgtggcacagagcggcctc
gaagacctcgtggtgatcaccggcgactggcattccgcgttcgtcgacgacatccgcccg
gacttcgcggatcccgccacccccgtgatcggcacggagttcaccgcgcactcggtcacc
tccggcgcctactcccccgagtggaacgccacgaacggaccgaagatgggcgcggccaac
ccgcacctcaagtacttcgaaggcgaccggtacggctacgacgtctacgaggtcaccccg
cgccgctggagcacgcacatgcgggtgatcggcgaccggcgcgacccgcgttccccggtg
agcaccctgacgacgttccacgtcgaccgcggccgggccgggtcctatgaggaccggtcc
accagcacgtctccggcacagtaccggcggcgctag

DBGET integrated database retrieval system