KEGG   Amycolatopsis japonica: AJAP_17705Help
Entry
AJAP_17705        CDS       T03225                                 

Gene name
bglA3
Definition
(GenBank) beta-glucosidase
  KO
K05350  beta-glucosidase [EC:3.2.1.21]
Organism
aja  Amycolatopsis japonica
Pathway
aja00460  Cyanoamino acid metabolism
aja00500  Starch and sucrose metabolism
aja01100  Metabolic pathways
aja01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AJAP_17705 (bglA3)
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    AJAP_17705 (bglA3)
Enzymes [BR:aja01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     AJAP_17705 (bglA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-ProteinID: AIG76409
UniProt: A0A075UVD3
Position
3738831..3740162
Genome map
AA seq 443 aa AA seqDB search
MKLHLPADFLWGAATAAYQVEGAVDADGRLPSIWDDFVRVPGAVLNGDTADVACDHYRRW
PEDLAIMKQLGLDAYRFSVAWPRVIPTGRGTVNAAGLDFYDRLVDALLEAGIRPFATLFH
WDLPSALTGGWPERDTAYAYADYAAVVAARLGDRVADWNTVNEPLCSAWLGYLEGRFAPG
VKDLKQAVDASHHLLLAHGLGVQAITANAARAANVGLVVNLSGIEPASDSAADVEAAKRM
DGHVNRWWLDPSNGRGYPADMIEVYGVEPPVVGNDLEVISTPVGFHGLNYYFRQIVEDDP
GGPAPRARQVPVEGAATTAMGWEIHGQGLADLIHRLANEYGARAIYVTESGAAFDDKVGE
DGSIHDADRIAYLEEHLGAVAGAAEAGAPVKGYFAWSLLDNFEWDSGLSKRFGLVRVDYD
TQVRTVKASGHRYAEIIAEHRKR
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
ttgaaactgcacctgcccgccgatttcctgtggggtgcggccaccgccgcgtaccaggtg
gaaggcgccgtcgacgccgacggccgtctcccgtccatctgggacgacttcgtccgggtc
ccgggtgccgtcctgaacggcgacaccgccgacgtcgcgtgcgaccactaccggcgctgg
ccggaggatctcgccatcatgaagcaactgggcctcgacgcctaccgcttctccgtcgct
tggccgcgggtgatcccgaccggtcgcggcacggtcaacgcggccggtctcgacttctac
gaccggctggtcgacgcgttgctcgaggccgggatccggccgttcgccacgttgttccac
tgggatctgccctcggcgctgactggcggctggccggagcgcgacacggcctacgcgtac
gccgattacgccgccgtcgtcgcggctcggctgggagaccgggtcgcggactggaacacc
gtcaacgaacccctgtgctcggcttggctcggctatctcgaaggccggttcgcccctggc
gtcaaagacctcaaacaggccgtcgacgcgtcgcaccatctcctgctcgcgcacggcctc
ggcgtgcaggcgatcacagccaacgccgcgcgcgccgccaacgtcggcctggtcgtcaac
ctcagcgggatcgagcccgcgtcggactcggccgcggacgtcgaggcggcgaagcggatg
gacgggcatgtcaaccgctggtggctcgacccgtcgaacggccgcggctacccggcggac
atgatcgaggtctacggcgtcgaaccacccgtggtcgggaacgacctcgaggtgatctcg
acgccggtcggcttccacgggctgaactactacttccggcagatcgtcgaggacgatccg
ggcggtcccgcgccccgtgcccggcaggtgccggtcgagggcgcggcgaccacggcgatg
ggctgggagatccacggacaggggctcgcggacctgatccaccggctcgccaacgagtac
ggcgctcgcgccatctacgtcaccgagagcggcgcggcctttgacgacaaggtcggtgag
gacggttcgatccacgacgccgaccgcatcgcctacctggaggaacacctgggcgcggtg
gccggggccgctgaagccggggctccggtgaagggctacttcgcctggtctctgctcgac
aacttcgaatgggacagcgggctgagcaaacggttcgggctcgtgcgggtcgactacgac
actcaggtccgcacggtcaaggcgagcggtcaccggtacgcggagatcatcgcggaacac
cggaaacgctga

DBGET integrated database retrieval system