KEGG   Amycolatopsis japonica: AJAP_31025Help
Entry
AJAP_31025        CDS       T03225                                 

Gene name
cobQ
Definition
(GenBank) Cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
aja  Amycolatopsis japonica
Pathway
aja00860  Porphyrin and chlorophyll metabolism
aja01100  Metabolic pathways
Module
aja_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:aja00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AJAP_31025 (cobQ)
Enzymes [BR:aja01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     AJAP_31025 (cobQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 GATase DJ-1_PfpI SNO DUF108 CobT Peptidase_C26
Motif
Other DBs
NCBI-ProteinID: AIG79027
UniProt: A0A075UXP4
Position
complement(6610339..6611796)
Genome map
AA seq 485 aa AA seqDB search
MSGLLVAGTTSDAGKSLVTAALCRWLARRGVRVAPFKSQNMSNNSMVCADGAEIGRAQWL
QARAARVEPEAAMNPVLLKPGSDRRSHVVALGKPFGTLEAGEYATGRAGLAEIAFDTFSS
LRKRFDVVLCEGAGSPAEINLREGDYVNMGLARRFGLPVVVVGDIDRGGVMAAMFGTLAL
LSAEDQALVSGWLVNKFRGDVGLLRPGLETLEKLTGREVLGVLPWLDQVWIDSEDALAAA
GWGASGGSLRVAVVRFPRASNATDVDALAAEPGVSVALTADPDTVRSADVVILPGSRATV
DDLAWLRARGLADAVRARAEAGRPVLGICGGYQMLAAEIEDDVESGAGTVPGLGLLPTRV
SFSADKVLARPTGSWRGQSVEAYEIHHGTVTATGPAESFLDGYRRGAVWGTMWHGAFEND
GFRRAWLGEVADWSPAAGAPGFGALRESMLDRLADAVEEHVDTEALLRLIENGADGSLPF
VPPGV
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcctgctcgtcgcggggacgacgtcggacgcgggaaagagcctggtcaccgcc
gcgttgtgccgctggctcgcgcgccggggcgtgcgggtggcgccgttcaagtcccagaac
atgtcgaacaactcgatggtctgcgccgacggcgccgaaatcggccgcgcgcaatggctt
caggcgcgggcggcccgcgtggaacccgaagccgcgatgaacccggtgctattgaaaccc
gggagcgatcggcgcagccacgtcgtcgcgctcgggaaaccgttcggcacgctggaagcg
ggggagtacgcgacgggccgggccgggctcgccgagatcgccttcgacacgttctcttcg
ctgcgaaagcgtttcgacgtcgtgctgtgcgaaggcgcgggcagcccggccgagatcaac
ctgcgcgaaggcgactacgtcaacatggggctggctcggcgcttcggcctgcctgtggtc
gtcgtcggcgacatcgaccgcggcggggtcatggccgcgatgttcggcaccctcgcgctg
ctgtccgccgaggaccaggcgctggtttcgggttggctggtcaacaagttccgcggtgac
gtgggtctgctgcggccgggactggagacgctggagaagctcaccggccgagaggtcctc
ggtgtgctgccgtggctcgaccaggtgtggatcgactcggaggacgcgctcgccgccgcg
ggctggggcgcctccggcgggtccctgcgcgtcgccgtcgtgcgtttcccgcgggcctcc
aacgcgaccgacgtcgacgcgctcgccgccgagcccggtgtctcggtcgcactgaccgcc
gacccggacacggtccggtccgccgacgtggtgatcctgccgggttcccgcgcgaccgtc
gacgatctggcgtggctgcgggcgcgtggtctggcggacgccgtgcgcgcacgggccgag
gcggggcgtccggtgctggggatctgcggcggctatcagatgctggccgccgagatcgag
gacgacgtcgaatccggggcgggaacggtccccggtctcggtctgctgccgacgcgggtc
tcgttcagcgccgacaaggtgctggccaggccgacgggttcgtggcgcggtcaatccgtg
gaggcgtacgagatccaccacggcaccgtgaccgccaccggccccgccgagtcctttttg
gacggataccggcggggcgcggtgtggggcacgatgtggcacggcgccttcgagaacgac
ggtttccggcgcgcctggctgggcgaggtggcggactggtcaccggccgccggggcaccg
ggcttcggcgcgctgcgggagtccatgctcgacaggctcgcggacgccgtcgaggagcac
gtcgacaccgaggctctgctgcgcctgatcgagaacggtgccgacggctctctgcctttc
gtgccgcccggagtctag

DBGET integrated database retrieval system