KEGG   Histoplasma capsulatum: HCAG_00010Help
Entry
HCAG_00010        CDS       T02229                                 

Definition
(RefSeq) fructose-bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
aje  Histoplasma capsulatum
Pathway
aje00010  Glycolysis / Gluconeogenesis
aje00030  Pentose phosphate pathway
aje00051  Fructose and mannose metabolism
aje00680  Methane metabolism
aje01100  Metabolic pathways
aje01110  Biosynthesis of secondary metabolites
aje01130  Biosynthesis of antibiotics
aje01200  Carbon metabolism
aje01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aje00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HCAG_00010
   00030 Pentose phosphate pathway
    HCAG_00010
   00051 Fructose and mannose metabolism
    HCAG_00010
  09102 Energy metabolism
   00680 Methane metabolism
    HCAG_00010
Enzymes [BR:aje01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     HCAG_00010
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: F_bP_aldolase
Motif
Other DBs
NCBI-GeneID: 5449673
NCBI-ProteinID: XP_001542964
UniProt: A6QRK4
AA seq 273 aa AA seqDB search
MSVKDVLSRKTGVIVGDDVLRLFEHAHENGYAIPAINVTSSSTVVAALEAARDKKSPLIL
QVSQGGAAFFAGKGISNTNQEASIAGATAAAHYIRSVAPSYGIPVVLHSDHCAKKLLPWL
DGMLDEDERYFKLHGEPLFSSHMIDLSEESVDWNIETTAKYLKRVTPMRQWLEMEIGITG
GEEDGVNNESVDNNSLYTQPEDIYAIYKTLSAISPYFSIAAGFGNVHGVYKPGNVRLHPE
LLAKHQAYVKEKTGSSKDKPVFLLFRRLRLLQG
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtaaaggacgttctctctcgcaagaccggcgtcattgttggcgacgatgtcctc
cgcctctttgaacatgcccacgaaaatggctatgcgattcctgccattaatgtaacctcc
tcctctactgtcgtggccgctctcgaggcagcccgtgacaagaagagccctctcatcctg
caggtgtctcagggtggtgctgcattctttgccggaaagggcatttctaatacgaaccaa
gaagcttccattgctggagccaccgcggcagctcactacatcagaagtgttgccccctcc
tatggcattcccgtcgtcctccactccgaccattgtgctaagaagctgctcccttggttg
gatggcatgctcgatgaggatgaacgctatttcaaactccacggcgagcccctcttctct
agccacatgatcgatctgtcggaggagtccgtcgactggaatattgaaaccactgccaag
tacctcaagcgcgttactcccatgaggcaatggctcgagatggaaatcggcatcaccggc
ggtgaagaagatggtgtcaacaatgaatcagtcgacaacaactccctctacacccagcct
gaggacatctacgccatctacaagaccctctcagccatcagcccctacttctccatcgcc
gccggcttcggcaatgtgcatggtgtctacaagcccggaaatgtccgcctgcacccagag
cttctcgccaagcaccaagcctatgtcaaggagaagaccggctcttccaaagacaagcct
gtcttcctcctctttaggcggctccggctcctccaaggctga

DBGET integrated database retrieval system