KEGG   Histoplasma capsulatum: HCAG_00329Help
Entry
HCAG_00329        CDS       T02229                                 

Definition
(RefSeq) hypothetical protein
  KO
K07756  inositol-hexakisphosphate 5-kinase [EC:2.7.4.21]
Organism
aje  Histoplasma capsulatum
Pathway
aje04070  Phosphatidylinositol signaling system
aje04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:aje00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    HCAG_00329
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    HCAG_00329
Enzymes [BR:aje01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.21  inositol-hexakisphosphate kinase
     HCAG_00329
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IPK Pam17
Motif
Other DBs
NCBI-GeneID: 5450046
NCBI-ProteinID: XP_001543283
UniProt: A6QSH3
AA seq 1571 aa AA seqDB search
MSTPALAPVDPSSTTLVTPVPDSSPDSSCLQSTPASNPRARAKAPGCGSLSQQPAHVAAP
IASGPLDTNASTAPLTPPPAPAPAGRLKPLDASFPLHRILAASPSSPSSISPCSYGPSVV
TPVTASSAASTSSVLRSRSPQLSERESIFATHYLPSDNDVNSIPAERAVGGASLIRPQLK
SATAADGYQTGEGEEREGRRPLPLPLPLATLQTSADRGASSAWDKSANNNPNSDNARNNY
NNTPLQFPDLRQDGNASSLSTDSVRKDSLKSISSSQPSFPLYASPPPPSPPRLSSPPLFS
MITTQLPQRTCGVVPGSGANDAGGSGATVTTSNQSHGIDTFLQRPSPTPNFTPAEHPLRS
IRLSRARTWDSLGAVSSILPDSSNAGARQTPVMTTSATATTSSSKSTPLMATKPFLRENN
TSAQSSSTTSTQQPDPSQFRPKSQSQSRSGDYSSDSRRDLPIARSSTKGHPSHLETSIEA
DLANAEPASNVRSRKSSHYLGLFKENTKSPERKKRDERLVERSVRDQECQLGGDGDYSGE
RGRVFPSENSSSSSRSQVILLPPDVSEPHQLQREDDENTHDEDGGSDVSDATDATPTQRA
RRNPLHSDIVEEKPRTDRWRKVPVDLLEEIKSYGGFVPPSTNSLPTTIMDRGSSALIFGP
DSTFGSNSVGSDSTQHLRGTGSDSYEDEERISSALYFPHKRADAEDVEVEVDIEQLNTPE
EEEPPEEDLKRSSIQKSHDGLPSEPFNHVDISLRSDGSTRHFHGDLPTAPEGQVSEGNDR
SLATISEFGHESTSESEFGSADETGLSAREEESSLTDDAGTIPAASTAHRNRYPTHPKRK
HAHGPTAPLGAVELKPYRHQVGGHTTVFRFSRRAVCKQLNNRENEFYERIERRHPEMLMF
LARYIGVLNVTFSKGPKRPKNKTDDIAVENGTAPSTSTNNGAEKASQVSKKTKDPESARI
FSQSQVTGVIPKVILENNRHIIPLDLFTSAGSANSGNTSGTRKTAGYDDDDDDDDDVARK
STSASSIRSHIPKRHGASWGATTVNTKLQEQVLREVFAPPPIHHHRRHSRGHNSFSRLRA
ETSRRRSHISIDCQSLQSDSSMGTVREGSAPPLLMNRNEDKKEANLSSSSASTVVNGDTH
VPEKLYIEEVHGRPKLVAPIASRIRRRHSGGGLERKRSMSNSKPGELVYFDDDGYGGDKE
DEILKMERDMPPRPASVESVMNPALGFDRASSADQRSETTLELATSRQNKNFPVAPEAST
GVPVRLPVNPKEARTTRDERVQFFLLLEDLTAGMNRPCVLDLKMGTRQYGIEATEKKKKS
QRRKCQTTTSQQLGVRLCGMQVWNIKKQDYLFEDKYFGRDLKAGRQFQDALTRFLYDGVS
YSSVTKKIPIILDKLARLENMVRRLPGYRLYASSLLILYDAEKSAEPEKPDDVTTTGDRD
SAAKQQRKKKPATDDGEGHNSFGLRVKIVDFANCITGEDGIPPDAPCPPHRPCDIDRGYL
RGLRSLRMYFQRILKEIKEEDYVERGEGEGMTFSQRGGSGMAIGREVGDDEYDGAFWEEG
VMDTDPGEVSL
NT seq 4716 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacacctgctctcgctcccgttgatccctcgtccacaaccctggtgacacctgtg
cccgattcttctcctgattcgagctgcctgcagtcgactccagcctccaatcccagagcc
agagccaaagcccccggctgcgggtcgctcagccaacagcctgcccacgttgctgcgccc
attgcatcaggaccactcgacactaatgcgtcgacggcaccccttacacctccacctgcg
cctgcgcccgcgggccggttaaaacccctcgatgcctcgttccctcttcaccggatactc
gctgcctccccgtcttctccctcctctatttcaccctgttcttacgggccctctgtagtc
acccccgtcactgcctcctccgccgcctccacctcctccgtccttcgatcccggagcccc
cagttgtccgagagggaaagcatctttgccacacattatctaccctcagacaacgatgta
aatagtattccggcggaaagggccgtgggaggagcttctttaatccgtccacagttgaag
tccgctacagctgcagacggatatcaaacgggagagggagaagaaagagaaggacgacgg
ccgctgccgctgccgctgccgctggcaacactgcagacgtcagcggaccgcggagcatca
tctgcgtgggataagagtgctaataacaaccctaacagtgataacgccagaaataattac
aataatacccctttgcagtttcccgaccttcgacaagatggcaatgcttcttctctgtcc
actgactccgtgcggaaggacagcctcaagtcgatttcttcttcgcagccttcgtttccc
ctgtacgcttctcccccgccaccctcgcctccccgactctcttcccctcccctcttctcg
atgattaccactcagcttccgcagcgaacctgcggtgttgtccctggaagcggcgccaat
gatgctggtggcagtggtgcgaccgtcaccacctctaatcaatctcacggaattgatacc
ttcctccaacggccttcgcctacccctaatttcacacccgcagaacacccgctacgatct
atacggctttccagagcaagaacctgggattcccttggagccgtctcctccatcctcccg
gattcctccaacgcgggagctaggcaaacacctgtcatgaccacatcagctacggctacg
acgagttctagcaaatcgacgcccttgatggcaacgaagccattcctcagagaaaataat
accagtgcccaatcatcatccacaacctcgacgcagcaacccgatccatcccagttccgt
cccaagtcccagtcccagtctcggtcaggggactactcctctgattctcgtcgagatctt
cccatcgcccgcagctcgaccaagggtcacccctcacacctagagacttccattgaagct
gatctggccaacgcagagccggcttctaacgttcggagtcgcaaatcaagccactaccta
ggtctgttcaaggagaatacaaaatctccagagcgcaaaaaacgagatgagcgtcttgtg
gagcggagtgttagggatcaggaatgtcaactcggtggtgacggtgattattctggcgaa
cgggggagagtgttccctagtgaaaactcctcctcttcatcacgttctcaggttatactc
cttccgccagacgtatcagagcctcaccagttacagcgggaggatgacgagaatacgcat
gatgaggatggagggagtgatgtatctgacgccactgatgccactcctacccaacgcgcc
cgccgaaaccctcttcactccgatatcgttgaagaaaaaccccggactgacaggtggagg
aaggttcccgttgacctcctggaagaaataaagagctacggcggcttcgttcctccttcg
acaaacagcttgcccactacgatcatggaccgtgggtcatcagcccttatttttggacca
gattccactttcggtagtaattctgtggggtctgacagtacacagcatcttagagggaca
ggttcagatagttacgaggatgaagaacgaatttcatcggcactctactttccacacaaa
cgtgccgatgcagaggacgtcgaagtcgaggttgatatcgagcagctcaacaccccagag
gaagaggaacctcctgaagaggatctcaagcgttcatccatccagaagagtcatgacggt
ctcccaagtgagccattcaaccatgtggacatatctttgcgttctgatggcagcactcga
catttccatggagacctgccaacggcccccgagggccaggttagcgaggggaacgaccgc
tcactggctacgatttcagagttcggccatgaatcgacgtctgagtctgagtttggttct
gcggacgaaaccgggctttctgcacgtgaggaagaatctagtttaactgacgatgctggt
acgattccggctgcttcgacagcgcaccgtaatcgctaccctacgcaccctaaacgtaaa
catgctcatgggcctactgctccgcttggagctgttgagctcaaaccttatcggcatcaa
gttgggggccataccaccgtatttagattttctcgacgagctgtttgtaagcaattgaat
aatcgggagaatgagttttacgagagaattgagcgtagacatccggaaatgttaatgttt
ctagcaaggtacattggtgttctcaatgtaacattctcaaaaggcccaaagcgaccaaag
aataagaccgatgatattgcagttgaaaacggaactgccccctccacttctacgaacaat
ggcgccgagaaagcctcgcaagtttcgaaaaagaccaaagacccagaaagtgcgcggatc
tttagccaatcgcaggttacgggcgtcattccgaaggtgatccttgagaataataggcat
ataattccgttagatctctttacctctgctgggtcagcgaatagtggaaatacttctggc
acccgaaaaactgctggttatgacgacgacgatgatgacgatgacgatgtcgcacgcaag
tcaacatcagcatcatccattcgttcgcatattccaaaacgacatggagcaagctggggc
gcgacaactgtaaatacaaaactacaggaacaggtccttcgggaggtttttgcaccgcct
ccaatccaccatcatcggcgccactctcgtggacataactccttctccagactgcgggct
gagacctcgcgaagacgaagccatatttcgatagattgtcagtctttacagagcgacagt
tccatgggtactgtgcgtgaaggatcagcccccccgcttctaatgaaccgtaacgaagac
aaaaaagaggccaacttatcgtcttcttctgcctctacagttgtgaatggggatacccat
gtgccagagaaattatatatagaagaagtacacggtcgacctaagctcgtggctcccatt
gcctcgcggatacggcgccgtcattctggcggtgggctggaaagaaaacgaagtatgagc
aatagtaaacctggggaactggtttattttgatgacgatggatatggtggggataaggaa
gatgaaatcttgaagatggaacgggatatgccaccgcggcctgcttccgtggaatctgtc
atgaaccccgcccttggttttgaccgggcttcttctgctgatcagcgcagtgagactact
ttggagctagccacttcgcgacagaacaaaaattttcccgtcgctccggaagcttccacg
ggggttcctgtacggctccccgtaaaccccaaagaagcacggactacacgagatgaacgg
gttcagttcttcctgctccttgaagaccttactgccggcatgaataggccgtgtgttctc
gatctaaaaatgggtactcgtcagtatggaatcgaggctactgagaagaagaagaaatct
cagagacgcaagtgccaaaccacgacatcgcaacagttgggagtgcggctttgtggaatg
caagtctggaatatcaaaaaacaagattatcttttcgaggataagtatttcgggcgtgac
ctcaaagctggacgacagttccaggatgcactcacaagattcttgtatgatggcgttagt
tactcaagtgtcacgaagaagatccctattatactcgacaaactcgctcggttggaaaac
atggtgcggcggctccccggttacaggctgtacgctagtagcctcttgatcctctatgac
gcggaaaaatccgcagaaccagaaaagcctgatgatgtcacgacaacaggcgatcgtgac
tctgccgcaaaacaacaaagaaagaagaaaccagccaccgatgacggagaggggcacaat
agttttggccttcgcgtgaaaattgtcgatttcgccaactgcatcacgggcgaagatggt
ataccacccgacgcgccctgtccgccccatcgcccttgtgatattgatcggggatacctg
cgcggcctgcgctcgctgcgcatgtattttcagcgcatattgaaggagattaaggaagag
gattatgtagagaggggggaaggggaggggatgacgttttcgcaacgaggtgggtcgggg
atggcaattgggagagaggttggggatgatgagtatgatggagcattttgggaggaaggg
gttatggatacagaccctggggaggttagcctttag

DBGET integrated database retrieval system