KEGG   Histoplasma capsulatum: HCAG_00793Help
Entry
HCAG_00793        CDS       T02229                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
aje  Histoplasma capsulatum
Pathway
aje00260  Glycine, serine and threonine metabolism
aje00750  Vitamin B6 metabolism
aje01100  Metabolic pathways
aje01110  Biosynthesis of secondary metabolites
aje01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aje00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HCAG_00793
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HCAG_00793
Enzymes [BR:aje01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HCAG_00793
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-GeneID: 5450086
NCBI-ProteinID: XP_001543747
UniProt: A6QTT7
AA seq 536 aa AA seqDB search
MSGTDSQRYLSTRGSSCGLSFEDVVLKGLASDGGLFIPEAIPQLPEGWESKWRDFTFQEL
AFEIMSLYISPSEIPPADLKNIINRSYSTFRSTDVTPLVTLDDSKQLYLLELFCGPTFAF
KDVALQFLGNLFEYFLARRNQGKSGKDRLHLVVIGATSGDTGSAAIYGLRGKEDTSIFIL
HPKGKVSAIQEAQMTTVLDPNVHNLSVQGSFDDCQAMVKSMFADPEMNLKYKLASVNSIN
WARILAQMTYYIHSYFSLTRSPKYTKDKSIRFVVPSGNFGDILAGWFAKQMGLLTEKLVI
ATNENDILDRFWKTGQYTKKPTGNGATGAEPSGVKETFSPAMDILVSSNFERLLWFLAIK
VFGGDGDIHLQRQRASDIVRRWLGDLQTQGGFRVEPAVLDAAKEHFESERVSDLETIDTI
RDIYSSCFPASPVSSGTRGSTGGYILDPHSAVGVAASLRSIDRNPGTHHISLSTAHPAKF
VSAVDMALGGQDGYEFDNIVPPEFAGLLRKERRVIEVPAGEGWKAVSKIIDANVKL
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgtcggggacggattcgcagaggtatctgagtactcggggctcatcatgcggactatct
ttcgaagatgtcgtgctgaaaggtcttgcgtcagatggcggcttgttcattccagaagcc
atcccccaactaccggagggctgggagtcaaagtggcgggatttcacattccaggagttg
gcatttgagattatgtctctgtatatctccccttcagagatccctccagcggatctaaaa
aatatcatcaaccgtagctattcgactttccgatcgacagatgttacgcccctcgttacc
ctcgatgactcaaagcaactctaccttcttgaactgttctgcggcccgacgtttgcattc
aaggatgttgctctgcagttcctcggaaacctctttgagtattttcttgcacggcgaaat
caagggaagagtggaaaagaccgactgcacctcgttgtgatcggagctacgagtggagac
accggttccgctgctatatatggcctgagagggaaggaagatacttcgatattcattctg
catcctaagggaaaagtctctgctatccaagaggcccaaatgacgaccgtcctcgatccc
aatgtccataaccttagcgttcaaggctccttcgatgactgccaagctatggtcaaatcg
atgtttgctgatccagagatgaacctcaagtacaagttggcgagtgtgaactcgataaat
tgggcgcgcatccttgcccaaatgacttactacattcactcttatttctccctcaccaga
agtccaaaatacaccaaagacaagtccataaggtttgtcgtaccatcaggtaatttcggt
gatatccttgctggctggtttgcaaaacaaatgggccttctcacagagaagctagtcatc
gcaacaaacgaaaacgacattcttgaccgattctggaaaaccggccaatataccaagaaa
cctaccgggaatggggccacaggcgcggagccgagtggcgtcaaagaaaccttcagccca
gccatggatatcctagtctcaagcaatttcgagcgcctcctctggtttctcgccattaaa
gtctttggcggagacggagatattcatctacagcggcaaagagccagcgatatcgtccgc
agatggcttggcgatctgcaaactcaaggcggcttcagagttgagccagccgttcttgat
gctgccaaagaacatttcgaatctgagcgtgtctccgatttggaaaccatcgacactatt
cgcgacatctactcctcttgtttccccgcctccccagttagtagcggaacaagaggcagc
acgggtggatacatccttgatccacactccgctgttggagttgctgcttcccttcgatct
attgatcgcaaccctggcacacatcatatttctctgtcaacggcacacccagcaaaattc
gtttcagctgttgatatggcgctaggaggccaggatggctacgagtttgacaacattgtt
ccaccggagtttgcggggttgttgaggaaagagcgccgtgtgattgaggttcctgcggga
gaagggtggaaggccgtgagcaaaattatcgacgcaaatgttaagttgtag

DBGET integrated database retrieval system