KEGG   Histoplasma capsulatum: HCAG_01084Help
Entry
HCAG_01084        CDS       T02229                                 

Definition
(RefSeq) hypothetical protein
  KO
K10739  replication factor A2
Organism
aje  Histoplasma capsulatum
Pathway
aje03030  DNA replication
aje03420  Nucleotide excision repair
aje03430  Mismatch repair
aje03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:aje00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    HCAG_01084
   03420 Nucleotide excision repair
    HCAG_01084
   03430 Mismatch repair
    HCAG_01084
   03440 Homologous recombination
    HCAG_01084
DNA replication proteins [BR:aje03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    HCAG_01084
DNA repair and recombination proteins [BR:aje03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     HCAG_01084
   MMR (mismatch exicision repair)
     HCAG_01084
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     HCAG_01084
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA_anti-codon RPA_C
Motif
Other DBs
NCBI-GeneID: 5451395
NCBI-ProteinID: XP_001544038
UniProt: A6QUM8
AA seq 247 aa AA seqDB search
MVRKVAWAEGVSQAVKEVAKEAGYMKNSLRPVTIKQTLDATQAHGDADFKIDGTEVSQVT
FVGQVRAVSHLTTFVTYKLDDGTGEIEVKLWLEKNAVNPTGDDMDTGDAPRSSESEIPIN
GYAKVWGKLNNFNNRRNFVAHVIRPITNIDEYNCHFLEATAIHLYYTRGPVGGHLGNERP
LPGATHPSGGGPLAGKTLPPMSPLARKMYETLSNTPQSNEGLHVQHLASLMGLPVGRDDS
TLAILEY
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgcaaggtggcatgggcggagggggtttcacaggcggtgaaggaggtagccaag
gaggcaggctatatgaaaaactcgcttcgtcctgtgacaattaagcaaacgctggatgcg
acccaagcgcatggagatgcagattttaaaattgatggcacggaggtatcacaggtaacc
ttcgtcggccaggtccgcgctgtcagccaccttactacatttgtcacttataaacttgac
gacggcacgggggaaattgaagtaaaattatggctcgaaaagaacgcagtcaatcccaca
ggagatgatatggatacgggagatgctccacgctcctcggaatcagaaattccaatcaac
gggtacgccaaagtttggggaaaacttaataacttcaacaatcgacggaatttcgtcgcg
catgtcatccgccctataacgaacattgatgaatacaattgccattttctcgaagccaca
gcgattcacctatactatacgcgaggcccagtagggggccatctggggaatgagaggccg
ctccctggtgcaacacatcccagcggtggtggtcctctcgccggaaagactttgcctcca
atgtcgccgctggctcggaagatgtatgagactttgagcaacacgccacagagcaacgaa
ggactccacgtgcaacacctggcgtcactgatgggtttgcctgttggccgagatgacagc
accttggcaattctagagtattaa

DBGET integrated database retrieval system