KEGG   Histoplasma capsulatum: HCAG_01988Help
Entry
HCAG_01988        CDS       T02229                                 

Definition
(RefSeq) similar to potential cytoplasmic methionyl tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
aje  Histoplasma capsulatum
Pathway
aje00450  Selenocompound metabolism
aje00970  Aminoacyl-tRNA biosynthesis
aje01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aje00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    HCAG_01988
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    HCAG_01988
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:aje01007]
    HCAG_01988
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:aje03016]
    HCAG_01988
Enzymes [BR:aje01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     HCAG_01988
Amino acid related enzymes [BR:aje01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   HCAG_01988
Transfer RNA biogenesis [BR:aje03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    HCAG_01988
 Prokaryotic type
   Other AARSs
    HCAG_01988
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 Elongin_A DUF4090
Motif
Other DBs
NCBI-GeneID: 5449927
NCBI-ProteinID: XP_001544941
UniProt: A6QX81
AA seq 638 aa AA seqDB search
MSTEQKILPKKGQRNILITSALPYVNNVPHLGNIVGSVLSADVYQKACGRPTLYICGTDE
YGTATETKALEEGVTPEELCAKYNKIHQEVYEWFEIGFDIFGRTPTAQHTEISQAIFKRL
YDNGFLEEKTAEQPFCEKHDSFLADRYVEGECPRCGYDDARGDQCDKCGHLLDPFDLKNP
RCKLDGATPVRRNTKHIHLLLDKLQPEIEAWVHPAIEKGDWPKNSRVITESWLKEGLKDR
GITRDLKWGVPVPLDGYEKKVLYVWFEACIGYPSITANYTPDWELWWRDPDNVQLYQFLG
KDNVPFHSVIFPGTQIGTRDKWTKLHHLSTTEYLNYENGKFSKSRGIGVFGNNAKETGVP
ADVWRYYLLKNRPETGDTQFEWRSFVDANNGELLAKLGNLVNRMVKLIASPKAYSSIVPD
FTVTEPFTPVLGEITTLLRQYITEMEGVHLRAGVATAMRIVEVGNGLIQSNKLDNSLIAS
EPERAASVVGIVINLIHLISSIFSPYLPATSASILEQLNVPFANIPSLDELKDEGWKPAL
IKPGHQIGKAKYLFSQIDPKKADEWREMFGGSQAERLKKEQDAAKALAKKAATKAKKKEK
KNKSKGDGMMDGGSGNNNNNEAVEKLADGVEQTTISSS
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacggaacaaaagatcctccccaagaagggccagaggaatatcctcatcaccagt
gccctgccctatgtaaataacgtccctcaccttggcaacattgtcggctctgtcctcagc
gctgatgtataccagaaagcatgcggaaggcctacgttatacatttgcggcaccgacgag
tacggcaccgcaacggaaaccaaggcgctggaggaaggggtgacgcccgaggaactttgc
gcaaagtacaacaaaatccaccaggaggtctacgaatggtttgagattggtttcgatatc
ttcggacgcacgccaactgctcagcacacggaaatttcccaggcgatcttcaagcggctg
tatgacaatggatttctagaggaaaaaaccgccgaacagccattctgcgagaaacatgac
tcatttcttgcggaccgctacgtcgagggtgaatgcccacgctgcggctacgatgacgcg
aggggggaccaatgcgataaatgcgggcacttgctggatccctttgatcttaaaaacccc
cgctgcaagcttgatggagcaacgcccgtccggcggaataccaaacatatccatcttttg
ctggataagctgcagccagaaattgaagcatgggttcatcccgccatcgaaaagggagat
tggcccaagaacagccgtgttattaccgagtcatggctaaaggagggtctgaaagatcgt
ggtatcaccagagatctgaaatggggtgtccctgtccctcttgacgggtacgagaagaag
gtcctctacgtctggttcgaggcgtgcatcggatacccttccatcaccgcaaactacacc
ccggactgggagctctggtggcgggacccggacaatgtccaactttatcaattcctaggc
aaggacaacgttccattccacagcgtcatcttcccgggcacccagattggaacaagggac
aaatggaccaagctccaccacctcagtacaaccgaatacttaaactacgagaacggcaaa
ttcagcaagtcccgcggaatcggcgtcttcggcaacaacgcaaaggaaaccggcgtcccc
gcagacgtatggcgctactacctgctaaaaaaccggcccgaaacgggcgacacgcaattt
gaatggcgctcgttcgtcgatgcaaacaacggcgaactcctcgcaaagctcggcaacctg
gtcaaccgcatggtgaagctgatcgcaagcccgaaggcgtacagctccatcgtccccgat
ttcaccgtcaccgagcccttcacacccgttttgggggagatcaccaccttgctgcgccag
tacatcaccgagatggaaggcgtgcatctgcgcgccggcgtcgcgacggccatgcgcatc
gtagaggtcggcaacggcctcatccagtccaacaagctcgacaactcgctgatagccagc
gagccagagcgcgccgcctccgtcgtcggcatcgtcatcaacctcatccacctcatctcc
agcatcttcagcccgtacctgccggccacgtcggcgtcgatcctcgaacagctcaacgtg
cccttcgcgaacatcccctcgctcgacgagctcaaggacgaagggtggaaaccggccctg
atcaagccgggccatcagattggtaaggcgaagtatctgttttcgcaaatcgatccgaag
aaggcggatgagtggcgggagatgtttggcggctcgcaggcggagaggctgaagaaggaa
caggatgccgcgaaggcgttggcgaagaaggcggcgaccaaggcgaagaaaaaggagaag
aagaataagagtaagggggacggcatgatggatggaggtagtggtaataataataataat
gaggcggtggagaagctggcggatggggttgagcagactacgatatccagctcttga

DBGET integrated database retrieval system