KEGG   Histoplasma capsulatum: HCAG_03176Help
Entry
HCAG_03176        CDS       T02229                                 

Definition
(RefSeq) hypothetical protein
  KO
K15450  tRNA wybutosine-synthesizing protein 3 [EC:2.1.1.282]
Organism
aje  Histoplasma capsulatum
Brite
KEGG Orthology (KO) [BR:aje00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:aje03016]
    HCAG_03176
Enzymes [BR:aje01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.282  tRNAPhe 7-[(3-amino-3-carboxypropyl)-4-demethylwyosine37-N4]-methyltransferase
     HCAG_03176
Transfer RNA biogenesis [BR:aje03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    HCAG_03176
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TYW3 LSDAT_euk
Motif
Other DBs
NCBI-GeneID: 5448251
NCBI-ProteinID: XP_001541079
UniProt: A6R0L9
AA seq 360 aa AA seqDB search
MASPGPGFKAKKQKIIRDLSVPDEEYTDLSPKGSIDAGIRDLIHNINQMPGLVTTSSCAG
RISVFLEVGGSGRERKGLGDKEGSSVKEDDRKIVEAEGDIGESSERPPQFAPTGGKGSGN
WLFVSHEPVEIDLDCEGNYLHRMFNLVPMDEKIGTINHSGSLRLVRFHFEPMILHIMASS
LQHAQPVLAAATMAGFRESGIQSLRCLNDSEAYPIVAVRSSGLALESIIGFHQQCIKSKS
KDVIAKSLVSEVYLRMLLAVANERFKTNANRRDRFWTKLQELSTGHAGDLSSRRAGWEDP
EVRRERKREEGLRRSRAAMGPKVARRKLDLFGDIMSEEDIMRTCFARKTISRTWEYDSVT
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggcctcccctggacccggcttcaaggctaaaaagcagaagattatacgcgatctgtcc
gtcccagatgaagaatatacagatctctcacccaagggatctatagatgcgggaatccgc
gatttgattcacaatatcaaccaaatgcctggcctggttacgacaagcagctgcgccggt
agaatcagcgtattcctagaagtgggtggaagtggaagagaaaggaaaggactaggagat
aaagaaggctcttctgtcaaagaagatgatcggaagatcgtagaagcagagggggatatc
ggagaaagttcagaaagaccaccgcagtttgcacccacgggaggtaaagggagtggtaac
tggttattcgtatcccatgagccggtggagatagacctggactgtgaaggcaattacctt
cacaggatgtttaatctggttcccatggacgagaaaattggaacaataaaccattccggt
agcttgaggcttgtccgttttcattttgaaccaatgattctccacattatggcatcatct
ctacaacatgcccagccggtcctcgcagctgccacaatggccggtttccgagaaagtggc
atacaaagcctgcggtgtttaaatgattcggaagcgtaccccattgtggcagtccgttca
tccggacttgcccttgagtccatcatcgggttccatcaacaatgcatcaaaagtaaaagc
aaggatgtcattgctaagagcctagtttctgaagtttatctccgcatgttgcttgcagtt
gcaaatgagaggtttaagacgaacgcaaaccggcgagatagattctggacgaaattacag
gaacttagtacagggcatgccggtgatctttcttcaagaagggctggttgggaagatcct
gaagtgcgaagggaaaggaaaagggaggagggattaaggcggagtagagccgcgatgggg
ccaaaggttgctcgaaggaaacttgatctatttggtgatattatgagtgaggaggatatt
atgaggacatgtttcgcccgcaagacgataagccgcacatgggaatacgacagtgtcacg
tag

DBGET integrated database retrieval system