KEGG   Histoplasma capsulatum: HCAG_03433Help
Entry
HCAG_03433        CDS       T02229                                 

Definition
(RefSeq) hypothetical protein
  KO
K17498  transcription factor SPN1
Organism
aje  Histoplasma capsulatum
Brite
KEGG Orthology (KO) [BR:aje00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:aje03021]
    HCAG_03433
Transcription machinery [BR:aje03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     HCAG_03433
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Med26
Motif
Other DBs
NCBI-GeneID: 5448296
NCBI-ProteinID: XP_001541336
UniProt: A6R1C6
AA seq 423 aa AA seqDB search
MSASPEPAAAESPLVDKEDDSMQHKEDDIAKLDLSDDESVLSDVDDAQFEDFDAANVSID
ERPAIAIDEENLKLIGRHKRARNQEEEEQRKKKKSKEGRREKKSRRRQESDDAFSGGEEI
EGKRARKRREDGEKRSRKIVEEINEEDLDPATRRRRALDRMMDEQLKKPTKRRARKADGI
DLADLADAEIEDVRRRMTDAAKLDSIARKENRPAMHKLKMLPEVVSLLNRNQYVNSLVDP
EINLLEAVKFFLEPLDDGSLPAYNIQRDLLAALGRLPINKETLIASGIGRVIVFYTKSKR
PEIGIKRQAERLLAEWTRPILQRSDDYSKRVYEEAYFDPSQLAARNQGVSAQATAAEARA
RELLPPRLANRARVEAGHTSYTIVPRSTTVQESRFARPLGASGEDRFRRMKARQAAAMKA
SKR
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcctcacccgagccagcagccgcagaatctcccctagtggacaaggaagatgac
agcatgcaacacaaggaggacgacatcgcgaaactggacctttcagacgatgaatctgtc
ctttccgacgtcgacgacgcgcagttcgaagacttcgatgccgcaaacgtttcgattgac
gagcggccggccatcgccatagacgaggagaacctcaagctcattggccggcataagcgt
gcacgcaatcaggaggaggaggagcagcggaagaagaagaagagcaaagaggggcgtaga
gagaagaagagtcgcaggcggcaggagagcgatgatgcgtttagtggtggggaagaaata
gagggaaaacgggcgaggaagcggagggaggacggtgagaagcggagtaggaagattgtg
gaggagattaatgaagaggacctggaccctgctacgcgtcgtcgccgcgcgcttgatcgt
atgatggatgagcagcttaagaagcctaccaaacggcgtgctcggaaggcggatgggatt
gatctcgccgacctggctgatgcggaaatcgaagatgttcgaagacggatgaccgacgcg
gccaagctggacagtatagctcggaaagagaaccggcccgcgatgcacaaattgaagatg
ctcccagaagtggtttcgctcctaaatcgcaaccaatatgtcaacagcctagtcgacccg
gaaatcaaccttctcgaagcggtcaaatttttcctggagccactggacgacggttccctg
ccggcatataacatccagcgtgatctccttgcggcactaggtagactccccatcaacaag
gagacgctcattgccagtggcattggcagggtcattgtattctacaccaagagtaagcgg
cctgagattgggatcaagcgccaggcggagcgtcttctcgccgaatggacccgtccgatc
ctgcagcgcagcgatgattattcgaagagagtctacgaggaagcctattttgatcccagt
caacttgctgctcgcaaccagggggtatcagcacaagccaccgctgcagaggctcgcgca
cgagaactgctaccgcctcgcctcgccaaccgagcgcgtgtcgaagctggacacacctcg
tataccattgtgccgcgctcgaccacggtgcaggagagcagatttgcgcgtcccctgggc
gcaagtggcgaggatcgatttaggcggatgaaggcccgacaggcggcagcgatgaaagcg
tcgaagaggtaa

DBGET integrated database retrieval system