KEGG   Histoplasma capsulatum: HCAG_03836Help
Entry
HCAG_03836        CDS       T02229                                 

Definition
(RefSeq) cell division control protein 3
  KO
K16944  septin 7
Organism
aje  Histoplasma capsulatum
Brite
KEGG Orthology (KO) [BR:aje00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aje04131]
    HCAG_03836
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:aje04812]
    HCAG_03836
   04147 Exosome [BR:aje04147]
    HCAG_03836
Membrane trafficking [BR:aje04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    HCAG_03836
Cytoskeleton proteins [BR:aje04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     HCAG_03836
Exosome [BR:aje04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   HCAG_03836
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin MMR_HSR1 GTP_EFTU ABC_tran AAA_16 Roc AAA_22 Ras RsgA_GTPase AIG1 AAA_29 ATP_bind_1 Dynamin_N AAA_24 RNA_helicase AAA_7 DUF2937 Exonuc_VII_L Caldesmon
Motif
Other DBs
NCBI-GeneID: 5447602
NCBI-ProteinID: XP_001541738
UniProt: A6R2H8
AA seq 405 aa AA seqDB search
MRNVVRRKLTGYVGFANLPNQWHRKSVRKGFNFNVMVVGESGLGKSTLVNTLFNTSLYPP
KERKGPSLDIIPKTVAIESISADIEENGVRLRLTVVDTPGFGDFVNNDDSWRPIVENIEQ
RFDAYLEAENKVNRMNIVDNRVHACVYFIQPTGHSLKPLDIEVMRRLHTKVNLIPVIAKA
DTLTDEEIALFKQRILADIQHHSIQIFEGPRYELDDEETIAENQEIMSKVPFAVVGANSE
VTSSEGRKVRGRRYPWGVIEVDNEEHCDFVKLRQMLIRTHMEELKEHTNNALYENYRSDK
LTQMGVAQDPSVFKEVNPAVKQEEERTLHEQKLAKMEVEMKMVFQQKVQEKESKLKQSED
ELFARHREMKEQLERQRAELEEKKSRLESGRPLEDKIKRKGFSLR
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaggaacgtcgtccgccgcaagttgaccggttatgttggattcgccaacctcccaaac
caatggcatcgtaaaagtgttcgcaagggtttcaacttcaatgtgatggttgtcggtgaa
tctggcttgggaaagtctactcttgtcaatactttgttcaacacttccctgtatcctcca
aaggaacgcaagggccctagcctggatattattccaaaaaccgttgccattgagtctatc
agcgccgatattgaggaaaacggcgttcgtctccgtctgactgtggttgatacacctggt
ttcggtgactttgtcaacaacgatgactcctggcgtccaattgttgagaacatcgaacag
cgcttcgacgcttacctcgaggccgagaacaaggttaaccgcatgaatattgtggacaat
cgtgtccatgcttgcgtctacttcatccagccaacaggccactcgctgaagccgcttgac
attgaggtaatgcgccgattgcataccaaggtcaatcttatccctgtcattgccaaagcc
gatactctcaccgatgaggaaattgctcttttcaagcaaaggattctggccgatatccaa
catcattccatccaaatcttcgaggggccccgatacgagcttgatgatgaagaaaccatc
gccgagaaccaggaaatcatgtccaaagttccttttgctgttgttggagcgaactcggag
gtcaccagcagtgagggccgcaaggtcagaggtcgtcgttatccatggggtgtcatcgag
gttgacaacgaggaacattgcgatttcgtcaaattgcgccagatgctcatccgtactcat
atggaagaactcaaggaacacacgaataatgccctgtacgagaactaccgatctgacaaa
ctcacacagatgggtgttgcgcaggacccaagtgtattcaaggaggtcaaccctgcagtc
aagcaggaagaagaacgcaccttgcacgaacagaaactcgcaaagatggaggtcgagatg
aagatggttttccaacaaaaggtgcaggagaaggaaagcaagctcaagcagagcgaagac
gagcttttcgcgcgacatcgcgagatgaaagaacaattagagcgacaacgcgcagaattg
gaagaaaagaagtctcgcctcgaaagtggaagacctctcgaggacaagataaagagaaag
ggtttctcgctccgttaa

DBGET integrated database retrieval system