KEGG   Histoplasma capsulatum: HCAG_03912Help
Entry
HCAG_03912        CDS       T02229                                 

Definition
(RefSeq) similar to phospholipase A2
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
aje  Histoplasma capsulatum
Pathway
aje00564  Glycerophospholipid metabolism
aje00565  Ether lipid metabolism
aje00590  Arachidonic acid metabolism
aje00591  Linoleic acid metabolism
aje00592  alpha-Linolenic acid metabolism
aje01100  Metabolic pathways
aje01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aje00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    HCAG_03912
   00565 Ether lipid metabolism
    HCAG_03912
   00590 Arachidonic acid metabolism
    HCAG_03912
   00591 Linoleic acid metabolism
    HCAG_03912
   00592 alpha-Linolenic acid metabolism
    HCAG_03912
Enzymes [BR:aje01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     HCAG_03912
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B
Motif
Other DBs
NCBI-GeneID: 5448240
NCBI-ProteinID: XP_001541814
UniProt: A6R2Q4
AA seq 820 aa AA seqDB search
MFRAQDVRNDSAGNCGAWEKGEDGVKGIPPSLNQPGNSSRTLRTPPGALTQSQLPPVGSN
PPSRVPGKLPIEPPTSQSAWDAFISKIGVVKDFLGSPSWPELIKQYVVPGWAALLPATIQ
TLQRELTMAKGSLADEIWSESHDAELNPEITQEARVRIGEGLCREERYFRWRRRQAMIKS
LAAYIGLQENDIHPDDIPVIAICSSGGGLRALVAGAGSYLAAKEAGLWDCTMYTAGVSGS
CWLQAIYNSSLGEQDFGKVVQHLKNRLGIHIAFPPEVLKQLTTAPTNKYLLRGLVEKLKA
SPESEFGLVDIYGLLLTSRLLIPTRQPLDLRDSDLKLSNQRVFTENGANPLPIYTAVRHE
IPPGDTNVPDTPTKPISDESKQGPKQETWFEWFEFTPYELFCEEFTAGIPMWATGRQFWE
GRDVPTSKDFAVPELRISVFMGIWGSAFCATLAHYYKEVRPVLRGLAGCGGIDAVLDGNR
DELIRVHPFDPATIPNFTLGLKGRLPKTCPESIFTDKELHLMDAGMSNNLPIYPLLRPGR
DVDLIVVFDASADIKEENWLSVVEGYARQRGVKGWPVGSGWPKLAANPAETAKSIEDAAI
SSMKKTDQNISAAKEQNREQSNQSKGSNSGSIGTIPSVLQDSRKSSPDLEKADLDYCNVW
LGTTQEQTSTEEPPPSKRLFHLPPQDDSDSDFRLMQPDAGIAVVYFPLVKNPAAPAIKQS
PPPQPPSPSPTSSSAPGINSKKAKISPEIPEAVEPIDPAVSDFMSTWNFVYSPEQVDGVV
ALAKANFAEGEDRVKRVVRGIYERKKKARLQRMQSGELDG
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atgttccgagcccaggatgttagaaacgactcggctgggaattgtggcgcatgggagaag
ggggaagatggcgttaagggcattcctccttctttaaatcagccggggaacagctcaagg
acattacggaccccgcctggtgcgcttacccaatcacaattgccgccagttggaagtaat
cccccttccagggtgcccgggaagctgccaattgaaccgccaacgtcccaatcagcgtgg
gatgcattcatctcgaagattggagttgttaaagattttcttggttctcctagttggcca
gagctaatcaagcaatatgtcgtgccaggatgggcggctttacttcctgcgacgatccaa
acactccaacgagaattaacgatggccaaggggtctttggccgacgagatctggtcagag
tcccatgatgctgagttgaatcccgagataactcaggaagcccgggttaggattggtgaa
ggtctatgtcgcgaagagcggtatttccgatggaggcgaagacaagccatgatcaaatct
ctagcagcttatattggcttacaggaaaacgatatacatcccgatgatatacccgtaatc
gcaatttgcagttcagggggtggcctacgcgctctcgtcgcaggcgcaggctcttatctt
gctgcaaaagaggcagggctttgggattgcaccatgtataccgcaggtgttagtgggagt
tgttggttgcaagctatctacaattcctcactcggggaacaggattttgggaaggttgtt
cagcacttaaaaaataggctgggaattcacattgcattcccacctgaagtacttaaacag
cttacaacagccccaaccaataaatacttgttgaggggtttggtagagaagttgaaagct
agtccagagtcggagtttggattggtggatatctacggcttgctcttgacttctaggctt
ttaattccaacgagacaaccgttggatttacgcgatagcgacctaaagctttcgaaccag
agagttttcactgaaaatggtgccaatcctcttcccatatacaccgctgtgcgccatgaa
atccctccaggagatacaaacgtacccgatacccctacgaagcccatatcggatgaatca
aagcaggggccaaaacaagaaacgtggttcgaatggttcgaatttaccccatatgaatta
ttctgcgaggagtttaccgcaggaatacctatgtgggcgacagggaggcaattttgggaa
ggccgggacgttcccacttcgaaagacttcgccgtacccgaactacggatatccgtgttt
atgggaatttgggggagcgcattctgtgccactcttgctcattactacaaggaagtaaga
ccagttttgcgtggcctcgcgggatgtggtggcatcgatgctgtgctggatggtaaccgc
gatgaactaatccgtgtccatcctttcgatccggcaacaataccaaatttcaccctcgga
ctgaagggacgacttccaaagacgtgtccagagtcaatttttacggacaaagaactccac
cttatggatgctggaatgagcaacaatctacctatatatccccttctccgccccggccgc
gatgttgatctgattgtcgtttttgatgcgtcagccgacatcaaggaagaaaactggcta
tcggttgtggaaggatacgcacggcaaaggggtgtcaaagggtggccagttgggtcaggt
tggcccaaacttgcagcaaatcctgcagaaaccgcgaaatccatcgaggatgctgcgatt
agttcaatgaagaaaacagatcagaacatctccgctgcgaaggaacaaaaccgggagcaa
agcaatcagagcaaagggtcaaattcggggagcataggaaccattccaagcgttcttcaa
gattctagaaaatccagcccagatctagagaaggccgatcttgattattgcaatgtttgg
cttgggactactcaggagcaaacatccacagaagaacctcccccgtccaaaaggctgttc
catttgcctccgcaagatgattcggactcagacttcagattaatgcaaccagatgccggc
atagcggttgtgtacttcccacttgtgaaaaaccctgccgctcctgccataaaacagtct
cctcccccacaaccaccgtcaccatcaccaacatcctcgtccgctccaggcatcaactca
aaaaaagcgaaaatatctccagagataccggaagccgtggagcctattgatcctgcagtc
agcgatttcatgagcacgtggaattttgtttacagtccagaacaggtggatggcgttgtt
gcgcttgccaaagccaattttgcggaaggcgaagaccgagtgaaacgcgtcgtgcggggc
atttacgaaaggaagaaaaaggcgaggttgcaaaggatgcagtcaggggagcttgacggc
tag

DBGET integrated database retrieval system