KEGG   Histoplasma capsulatum: HCAG_05236Help
Entry
HCAG_05236        CDS       T02229                                 

Definition
(RefSeq) hypothetical protein
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
aje  Histoplasma capsulatum
Pathway
aje04011  MAPK signaling pathway - yeast
aje04139  Mitophagy - yeast
aje04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:aje00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    HCAG_05236
 09140 Cellular Processes
  09141 Transport and catabolism
   04139 Mitophagy - yeast
    HCAG_05236
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    HCAG_05236
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aje01001]
    HCAG_05236
Enzymes [BR:aje01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     HCAG_05236
Protein kinases [BR:aje01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   HCAG_05236
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like Pkinase_fungal Choline_kinase
Motif
Other DBs
NCBI-GeneID: 5446412
NCBI-ProteinID: XP_001539769
UniProt: A6R6H8
AA seq 369 aa AA seqDB search
MVLFTLHGVDGCSFCQPSTEVPVDKAEEQSVDQYTFETDLENEVPVAKGEEPFIQEVKLI
RVQVAGGRELAETLEEEVNLRALKIRGSNIMCSATDTLLGTQVAIKKIHHPFTRSELCQR
AYLELKLLKLLKHENIAGLQDAFISFGENLYLRTEHQGTTLDQYLASNMPEPRCTKVFFY
QLLRGLKYLHSSNIVHCDFKPSSILITGSCDLQITGLDHSCIRGERVMINYVYGNRDQSY
QAPELMLGAQAYQPAIDMWAAGCVSGAEALNCVNYSTHRFRKAMIGMKAIHSALIHHNDI
YPKNILIVPSTPERVVWIDFDVATTFPHRESMGCQELKYCDYEDALVASFGELLQDDQNQ
GLPPNTKYY
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggttctcttcaccttacatggtgttgatggctgctcattttgccaaccctccaccgaa
gttcctgttgataaagccgaagagcaatcagttgatcaatatacgtttgaaacggacctc
gaaaacgaagttcctgtagccaaaggcgaagaaccatttattcaggaggtaaaactcatc
cgcgttcaagtagccggcgggcgagaattggccgaaaccttggaagaggaggtaaaccta
cgtgctctcaagatcagaggctctaacattatgtgctcagccaccgacactttactcggc
actcaagtcgcaatcaagaaaatacaccatccgttcacccgctccgagctgtgccaaaga
gcctatctagaattgaagctgttgaagcttctcaagcacgaaaatattgctggcttgcaa
gatgcattcatatcattcggcgagaatttgtacctcagaacagagcaccaaggcacgacg
cttgatcaatatcttgcatccaacatgcctgaaccgcgatgtactaaagtattcttttac
caacttttgcgagggttgaaataccttcactcctcaaatatagtgcactgcgattttaaa
ccgtccagtatccttattaccgggagctgcgaccttcaaataaccggcctggaccactcc
tgtattcgtggtgagagagttatgataaattatgtttacggcaacagagatcaaagttat
caggccccggaactcatgttgggtgcacaggcttatcaacctgccatcgacatgtgggcg
gcggggtgtgtctccggcgcagaagcactgaactgcgtaaattactcaactcatcgcttc
cgtaaggcgatgatcggcatgaaagcgattcatagtgccctaatccaccacaatgatatc
tatcccaaaaacatcctaattgttcccagtaccccggaaagggtggtatggatagatttt
gacgtcgcaacaacgtttcctcatcgtgaatcaatgggttgccaagaattaaaatactgc
gattatgaggatgcgcttgttgcaagctttggggagcttttgcaagacgatcaaaaccag
ggtcttcctcccaacacaaaatactactag

DBGET integrated database retrieval system