KEGG   Histoplasma capsulatum: HCAG_06681Help
Entry
HCAG_06681        CDS       T02229                                 

Definition
(RefSeq) hypothetical protein
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
aje  Histoplasma capsulatum
Brite
KEGG Orthology (KO) [BR:aje00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aje01009]
    HCAG_06681
Enzymes [BR:aje01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     HCAG_06681
Protein phosphatases and associated proteins [BR:aje01009]
 HAD phosphatases
  Other HAD phosphatases
   HCAG_06681
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase
Motif
Other DBs
NCBI-GeneID: 5445745
NCBI-ProteinID: XP_001539076
UniProt: A6R8P0
AA seq 116 aa AA seqDB search
MASLTKDFPAIRACIFDMDGLLIDSEDIITMSINQFLEKHGRPTLSRSIRAKLMGVPNST
TSDVFHDWAQLRIPREQFAHEATEQMKMHFPSCRPLPGAQELLSNLSRAFCAANRR
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atggcttctcttacgaaagacttccccgccatccgagcatgcatttttgacatggacggt
ctcctcatcgactccgaagacataatcacgatgtccataaaccagtttcttgaaaagcac
gggaggcctactttaagccggtcaatccgggccaaactcatgggtgttccaaactcgact
accagtgacgttttccacgactgggctcaactgcgtatccctcgcgagcaattcgcccac
gaagcgactgagcagatgaaaatgcatttccctagttgcaggccgctgcctggcgcgcag
gagctactctcaaacctcagccgagcattctgtgctgccaacaggagatga

DBGET integrated database retrieval system